Clone BO27557 Report

Search the DGRC for BO27557

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:57
Vector:pDNR-Dual
Associated Gene/Transcriptsdt-RD
Protein status:BO27557.pep: Imported from assembly
Sequenced Size:2671

Clone Sequence Records

BO27557.complete Sequence

2671 bp assembled on 2010-09-13

GenBank Submission: KX796843

> BO27557.complete
GAAGTTATCAGTCGACATGGTCGTGTCCACTTTGCACATAACGCTGGAGA
ACAACGGCAATGTTGCTGCGGGGCAGCCTGCTGCCGTTGCTGCTGCCAGT
GTCGTTGGGGCAGCAACATCGCCGACCAAGTTTGCCGTGCTGTCGGCGCA
GCAGCTGCAACTGCAACTGCAGCAGCAGCAGCAGCAGCAGAACGAAAAGG
AGAACCATATGAACAATAATAACAATAACAGCGACTATTGTGATATGAAT
GGCAATGGAGTTGGAATGGGAAACGGTGGTAGTGGTGGACCGGGATCTCT
GACCCCCCAATCCCCCGACCAATATGTCGGCTCACCTGTATCATCCGCTG
CCACGCCCCAGCGCACCGCCTCCGCCCTGCGTCGCGGCATTCAAATTCAA
CGATCCTCGACGCGTTTGCGACAACAACAGGAGCAACTGCGCCGACGACG
CGAGGAGGAGGAGCGCATAGCGCAGCAAAATGAATTCCTGCGGAACAGTC
TTCGTGGCTCCAGGAAGCTGAAGGCGCTTCAGGATACGGCTACGCCCGGT
AAAGCGGTTGCCCAGCAGCAGCAGCAGGCAACGCTGGCCACCCAGGTGGT
TGGCGTGGAGAATGAGGCATATCTGCCCGACGAAGACCAGCCGCAGGCGG
AACAGATCGATGGCTATGGCGAACTGATAGCGGCCCTTACCCGCCTGCAA
AACCAGCTGAGCAAGAGCGGACTGAGCACGCTGGCGGGTCGCGTTTCGGC
CGCCCACAGTGTCCTGGCCAGCGCCAGTGTGGCCCATGTCCTGGCCGCTC
GCACCGCAGTACTGCAGCGACGACGTTCCCGCGTCTCTGGTCCACTGCAT
CACAGTTCCCTCGGATTGCAGAAGGACATTGTGGAGCTGCTAACGCAATC
GAATACGGCGGCGGCCATCGAGCTGGGCAACCTGCTGACCAGCCATGAAA
TGGAGGGTCTGCTACTGGCCCACGATCGCATTGCCAATCACACGGATGGC
ACGCCCTCGCCAACGCCCACGCCCACTCCGGCAATTGGAGCGGCGACGGG
ATCGACACTCAGCAGTCCGGTGGCTGGACCCAAGAGAAATCTAGGTATGG
TGGTGCCACCGCCCGTGGTACCACCGCCACTGGCGCAACGCGGAGCAATG
CCACTGCCTCGCGGGGAGTCGCCACCGCCGGTTCCCATGCCACCACTGGC
TACAATGCCCATGTCCATGCCCGTTAATCTGCCGATGAGTGCGTGCTTTG
GCACGCTAAACGATCAGAACGACAACATTCGTATCATCCAGATCGAGAAG
TCAACGGAGCCGCTGGGCGCCACAGTGCGCAACGAGGGTGAGGCGGTGGT
CATCGGTAGGATTGTGCGTGGTGGAGCGGCGGAGAAGTCGGGACTGTTGC
ACGAAGGTGATGAGATACTGGAGGTCAACGGTCAGGAGTTGCGTGGCAAG
ACGGTGAACGAAGTGTGCGCCCTGTTGGGCGCCATGCAAGGCACCCTGAC
CTTCCTGATCGTCCCAGCGGGTAGTCCACCGTCCGTCGGCGTGATGGGCG
GAACAACGGGCAGTCAACTGGCCGGGTTGGGTGGAGCACATCGTGACACC
GCCGTGTTGCACGTACGGGCGCATTTCGACTACGATCCAGAGGACGATCT
GTATATACCCTGCCGGGAGCTGGGCATCAGCTTCCAGAAGGGCGATGTAC
TGCACGTGATTAGCCGCGAGGATCCCAACTGGTGGCAGGCGTATCGCGAG
GGCGAGGAGGACCAGACGCTGGCCGGTCTTATTCCTAGTCAGTCGTTCCA
GCATCAGCGCGAGACCATGAAGCTGGCCATTGCGGAGGAGGCGGGTCTGG
CGCGATCCCGCGGTAAGGACGGATCGGGCAGCAAAGGAGCCACGCTCCTG
TGTGCGCGCAAGGGTCGCAAAAAGAAGAAGAAGGCCAGCTCCGAGGCGGG
ATATCCTTTATACGCCACCACGGCGCCGGATGAAACGGATCCGGAGGAGA
TACTCACCTACGAGGAGGTGGCCTTGTACTATCCCCGCGCTACCCACAAG
CGGCCCATCGTCCTCATCGGCCCGCCCAACATTGGAAGACATGAGTTGCG
CCAACGTCTGATGGCCGACTCGGAGCGTTTCTCCGCCGCAGTGCCACACA
CATCACGAGCCCGCAGGGAGGGCGAAGTGCCCGGAGTGGACTACCACTTC
ATCACGCGACAGGCCTTTGAGGCGGATATTTTGGCGCGCCGCTTTGTGGA
GCACGGTGAATATGAGAAGGCCTACTACGGCACATCACTGGAGGCCATAC
GCACGGTGGTGGCCAGCGGCAAGATCTGTGTGCTCAACCTGCATCCGCAG
AGCCTTAAGCTGCTGCGCGCCTCTGACCTCAAGCCGTACGTGGTGCTGGT
GGCGCCGCCCAGCTTGGACAAGCTGCGCCAAAAGAAGCTGCGCAACGGCG
AACCCTTCAAGGAGGAAGAGCTCAAAGACATCATTGCCACGGCCAGGGAT
ATGGAGGCCCGTTGGGGTCACCTATTCGACATGATCATAATCAACAACGA
CACGGAGCGCGCCTACCACCAACTGCTGGCCGAGATCAACTCGCTGGAAC
GCGAGCCCCAATGGGTGCCCGCCCAGTGGGTGCACAACAATCGCGACGAG
TCAGCAAGCTTTCTAGACCAT

BO27557.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
sdt-RK 2640 CG32717-PK 1..2637 17..2653 13185 100 Plus
sdt-RD 2640 CG32717-PD 1..2637 17..2653 13185 100 Plus
sdt-RN 3879 CG32717-PN 1651..3876 428..2653 11130 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:18:32
Subject Length Description Subject Range Query Range Score Percent Strand
sdt-RK 3790 CG32717-RK 170..2806 17..2653 13185 100 Plus
sdt-RD 3838 CG32717-RD 218..2854 17..2653 13185 100 Plus
sdt-RN 5650 CG32717-RN 2441..4666 428..2653 11130 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8235881..8237169 662..1950 6445 100 Plus
X 23542271 X 8232493..8232907 17..431 2075 100 Plus
X 23542271 X 8235585..8235821 427..663 1185 100 Plus
X 23542271 X 8237231..8237428 1950..2147 990 100 Plus
X 23542271 X 8238250..8238443 2460..2653 970 100 Plus
X 23542271 X 8238006..8238189 2279..2462 920 100 Plus
X 23542271 X 8237810..8237942 2148..2280 665 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:18:29 has no hits.

BO27557.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:49 Download gff for BO27557.complete
Subject Subject Range Query Range Percent Splice Strand
sdt-RD 218..2854 17..2655 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:55 Download gff for BO27557.complete
Subject Subject Range Query Range Percent Splice Strand
sdt-RD 218..2854 17..2655 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:08:13 Download gff for BO27557.complete
Subject Subject Range Query Range Percent Splice Strand
sdt-RD 218..2854 17..2655 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:08:13 Download gff for BO27557.complete
Subject Subject Range Query Range Percent Splice Strand
X 8238252..8238443 2462..2655 98   Plus
X 8238007..8238188 2280..2461 100 -> Plus
X 8237810..8237941 2148..2279 100 -> Plus
X 8237232..8237428 1951..2147 100 -> Plus
X 8235882..8237169 663..1950 100 -> Plus
X 8235592..8235820 434..662 100 -> Plus
X 8232493..8232910 17..433 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:55 Download gff for BO27557.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8132285..8132476 2462..2655 98   Plus
arm_X 8132040..8132221 2280..2461 100 -> Plus
arm_X 8131843..8131974 2148..2279 100 -> Plus
arm_X 8131265..8131461 1951..2147 100 -> Plus
arm_X 8129915..8131202 663..1950 100 -> Plus
arm_X 8129625..8129853 434..662 100 -> Plus
arm_X 8126526..8126943 17..433 99 -> Plus

BO27557.pep Sequence

Translation from 16 to 2671

> BO27557.pep
MVVSTLHITLENNGNVAAGQPAAVAAASVVGAATSPTKFAVLSAQQLQLQ
LQQQQQQQNEKENHMNNNNNNSDYCDMNGNGVGMGNGGSGGPGSLTPQSP
DQYVGSPVSSAATPQRTASALRRGIQIQRSSTRLRQQQEQLRRRREEEER
IAQQNEFLRNSLRGSRKLKALQDTATPGKAVAQQQQQATLATQVVGVENE
AYLPDEDQPQAEQIDGYGELIAALTRLQNQLSKSGLSTLAGRVSAAHSVL
ASASVAHVLAARTAVLQRRRSRVSGPLHHSSLGLQKDIVELLTQSNTAAA
IELGNLLTSHEMEGLLLAHDRIANHTDGTPSPTPTPTPAIGAATGSTLSS
PVAGPKRNLGMVVPPPVVPPPLAQRGAMPLPRGESPPPVPMPPLATMPMS
MPVNLPMSACFGTLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIV
RGGAAEKSGLLHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVP
AGSPPSVGVMGGTTGSQLAGLGGAHRDTAVLHVRAHFDYDPEDDLYIPCR
ELGISFQKGDVLHVISREDPNWWQAYREGEEDQTLAGLIPSQSFQHQRET
MKLAIAEEAGLARSRGKDGSGSKGATLLCARKGRKKKKKASSEAGYPLYA
TTAPDETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMA
DSERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYE
KAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSL
DKLRQKKLRNGEPFKEEELKDIIATARDMEARWGHLFDMIIINNDTERAY
HQLLAEINSLEREPQWVPAQWVHNNRDESASFLDH

BO27557.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
sdt-PK 879 CG32717-PK 1..879 1..879 4501 100 Plus
sdt-PD 879 CG32717-PD 1..879 1..879 4501 100 Plus
sdt-PN 1292 CG32717-PN 421..1292 4..879 3830 87.4 Plus
sdt-PI 1269 CG32717-PI 398..1269 4..879 3830 87.4 Plus
sdt-PE 1367 CG32717-PE 496..1367 4..879 3830 87.4 Plus