Clone BO27561 Report

Search the DGRC for BO27561

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:61
Vector:pDNR-Dual
Associated Gene/Transcriptinx7-RA
Protein status:BO27561.pep: Imported from assembly
Sequenced Size:1348

Clone Sequence Records

BO27561.complete Sequence

1348 bp assembled on 2010-08-18

GenBank Submission: KX797158

> BO27561.complete
GAAGTTATCAGTCGACATGCTGAACACCTTCAGTTCGGTGAGGCAGTACC
TCAAGTTCGATCTCACGCGTGTGGTCATCGACAATATAGTGTTCAAGCTG
CACTATCGATGGACCTTCGTAATACTCCTAGTGGCCACCCTCCTGATCAC
GTCGCGCCAGTACATCGGGGAGCACATCCAGTGCCTATCCGACGGTGTTG
TGTCTCCGGTCATCAACACCTTCTGCTTCTTCACGCCCACCTTCACAGTG
GTACGTGACCAGAACCAAACTGCCTACAGGCCGGGAAGTGAGCCACCTGG
TATAGGGGCATTCGATCCCGAAAAGGACACGATCAAGCGGCATGCATACT
ACCAGTGGGTGCCCTTTGTCCTGTTCTTCCAGGCTCTCTGCTTCTACATT
CCCCATGCCCTGTGGAAGAGTTGGGAGGGCGGCCGGATCAAGGCCCTGGT
CTTTGGTCTTCGAATGGTGGGTCTAACGAGGTACCTGAAGAACGATAGTC
TGCGTATCGGCAAGCTGAACATTCCCTCGATGGCGGAGGCGGAGGAGCGG
GTCAAGGACATTCGTCGCACAATGATCGACCGGATGCGGCTGAATCAATC
GTGGGGTGCCCACTTGGTCTTCGCGGAGGTGCTCAATCTGATTAATCTTC
TGCTGCAGATCACATGGACCAACCGTTTTTTGGGCGGTCAATTCCTCACA
CTGGGACCACATGCCCTGAAAAATCGGTGGTCCGACGAGCTGAGCGTTTT
GGATCTAGTATTCCCGAAGATTACCAAGTGCAAGTTCCACAAATTTGGTG
ACTCTGGCTCCATTCAAATGCACGATGCCCTTTGCGTGATGGCGCTGAAC
ATCATGAACGAGAAGATCTACATTATTCTGTGGTTCTGGTACGCCTTCCT
TTTGATTGTTACTGTTCTGGGACTGCTTTGGAGAATTTTAACCCTGTGCT
TCTACAGAAATGTCACATTTACCCGCTGGTCTCTCTATTGGGCCAAGCCT
GGCCAACTGGACGAAAACGAATTATTGGCGGTAATTGATAAGTGTAACTT
TTCCAACTGGATGTTCCTTTTCTTCCTGCGCTCCAACCTTTCGGAGTTCC
TATTCAAGAAGGTTATCTATCATTTGGCTAGTGAGTTCCCCAATCCCGAT
CACGATAACGATGTCAATGCCTATCGAGAGGCACCGCCCACGCCCGCTAA
GAACCGTTATCCGGAGCTCAGTGGTCTGGATACGATTGATTCACCACTCT
TGCACCTTCGACGCAATGGCTCGCCCTCTGCCGGCGGAGCCCAAGGGCCA
TCGACTTCGGATATGGCAAAGTTACCTGTAGCAAGCTTTCTAGACCAT

BO27561.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:44:59
Subject Length Description Subject Range Query Range Score Percent Strand
Inx7-RA 1317 CG2977-PA 1..1314 17..1330 6555 99.9 Plus
Inx7-RB 1086 CG2977-PB 2..1083 249..1330 5395 99.9 Plus
Inx3-RC 1188 CG1448-PC 724..841 773..890 185 77.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
Inx7-RA 1634 CG2977-RA 200..1513 17..1330 6555 99.9 Plus
Inx7-RB 1690 CG2977-RB 488..1569 249..1330 5395 99.9 Plus
Inx3-RC 1652 CG1448-RC 864..981 773..890 185 77.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6992173..6992883 960..250 3540 99.9 Minus
X 23542271 X 6991733..6992102 1330..961 1850 100 Minus
X 23542271 X 6993177..6993413 253..17 1185 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:44:58 has no hits.

BO27561.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:47 Download gff for BO27561.complete
Subject Subject Range Query Range Percent Splice Strand
inx7-RA 195..1508 17..1332 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:03 Download gff for BO27561.complete
Subject Subject Range Query Range Percent Splice Strand
Inx7-RA 200..1513 17..1332 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:38 Download gff for BO27561.complete
Subject Subject Range Query Range Percent Splice Strand
Inx7-RA 200..1513 17..1332 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:38 Download gff for BO27561.complete
Subject Subject Range Query Range Percent Splice Strand
X 6993180..6993413 17..250 100   Minus
X 6992173..6992882 251..960 99 <- Minus
X 6991731..6992102 961..1332 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:03 Download gff for BO27561.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6887213..6887446 17..250 100   Minus
arm_X 6886206..6886915 251..960 99 <- Minus
arm_X 6885764..6886135 961..1332 99 <- Minus

BO27561.pep Sequence

Translation from 16 to 1348

> BO27561.pep
MLNTFSSVRQYLKFDLTRVVIDNIVFKLHYRWTFVILLVATLLITSRQYI
GEHIQCLSDGVVSPVINTFCFFTPTFTVVRDQNQTAYRPGSEPPGIGAFD
PEKDTIKRHAYYQWVPFVLFFQALCFYIPHALWKSWEGGRIKALVFGLRM
VGLTRYLKNDSLRIGKLNIPSMAEAEERVKDIRRTMIDRMRLNQSWGAHL
VFAEVLNLINLLLQITWTNRFLGGQFLTLGPHALKNRWSDELSVLDLVFP
KITKCKFHKFGDSGSIQMHDALCVMALNIMNEKIYIILWFWYAFLLIVTV
LGLLWRILTLCFYRNVTFTRWSLYWAKPGQLDENELLAVIDKCNFSNWMF
LFFLRSNLSEFLFKKVIYHLASEFPNPDHDNDVNAYREAPPTPAKNRYPE
LSGLDTIDSPLLHLRRNGSPSAGGAQGPSTSDMAKLPVASFLDH

BO27561.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Inx7-PA 438 CG2977-PA 1..438 1..438 2339 100 Plus
Inx7-PB 361 CG2977-PB 1..361 78..438 1936 99.7 Plus
Inx2-PD 367 CG4590-PD 1..358 1..379 675 38.5 Plus
Inx2-PC 367 CG4590-PC 1..358 1..379 675 38.5 Plus
Inx2-PB 367 CG4590-PB 1..358 1..379 675 38.5 Plus