Clone BO27565 Report

Search the DGRC for BO27565

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG7101-RA
Protein status:BO27565.pep: full length peptide match
Sequenced Size:1090

Clone Sequence Records

BO27565.complete Sequence

1090 bp assembled on 2010-08-18

GenBank Submission: KX798153

> BO27565.complete
GAAGTTATCAGTCGACATGGAACCGGTGCCCATCCGGCCAAAAGCGCCGG
GAGCGAGCAACCGCGGAGCCCTGCCGCTGGCGGCGAAGAAGCCGGCCAAG
AAGCGTACGTACCACTGCGGCGTTTGTTTTGCGGAGTTCTCTCGTCATCT
GGCCGCCAAGCGGCACGAGCAGCAGTGCTCCGTCAGGGTGAGGCGTCTTT
TCGTCTGCCCCCACTGCCTGACGCTTTTCGGCGAGGAGGCCCGGCTGGAG
CGGCATCGGGAGCGAAAGCACAACGATGGCCAGTTCCTGTGCCTGCAGTG
CGGCAAGAAGTACGCGTCAGCCACGTTTCTTTACCGTCATGTTGCCAGTT
GGCACGGCCAGCAGTCGCTGTTCTACTGCGACATGTGCACGGACAACTGC
AACGACGTTAAGACCTTTAGCGGGATGCTGGAGCTGCAGGAGCACGCCGA
GGAGGTGCATCGCCTGCGTACCCTGAAGTCCACGGCCAGTGATGCAGACA
GCCAGGTTGATGAAATGGAGGATCTTGAGATGCTAGAGGAGAACATTGAG
AACATACTGCCCAGCATCGACTGGGACGACGATCTCACCTTTGGCTGGCC
CACCGACCTGGACAAGGAGTCGTGCATTGTGAACGCTAAGCCGAGCGTTT
TCGTGTGTCCCTTCTGCGCCAACGGATTCCCCGGCAGTCTGAGCCTGGTG
CGGCACCTGGAGCAGGTTCACGAACGCAGTGCCCTGGACTGCTGCTACTG
TGGCAAGAGCCATGGCAGCCGAGAAGCCCTGCGGTCCCATCTGCAACGTG
TTCACATCCTCTTGCGCGGTCATGTGTGCGGTATTTGCCAGGCGGACTTC
GCCACTGCTGATCACCTAAAGAAGCACGTTAACAGTCTGCACCTGGACCA
CCGACCGCATCTGTGTCCCACGTGCGGAAAGAGATTCACCCAGCGGTGCC
ACCTCACCGATCACATAAAGACGGATCGCGGCCATGGACACGGCACTTAC
ACCTGTGAATTCTGCGTGCGGCCCTTCTTCCGGGCCATCGATCTCGAACG
GCATGTGTGTGAGGAACATCCGGCAAGCTTTCTAGACCAT

BO27565.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG7101-RA 1059 CG7101-PA 1..1056 17..1072 5280 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG7101-RA 1454 CG7101-RA 73..1128 17..1072 5280 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18831218..18831797 493..1072 2900 100 Plus
X 23542271 X 18830663..18831143 17..497 2405 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:44:49 has no hits.

BO27565.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:45 Download gff for BO27565.complete
Subject Subject Range Query Range Percent Splice Strand
CG7101-RA 58..1113 17..1074 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:00 Download gff for BO27565.complete
Subject Subject Range Query Range Percent Splice Strand
CG7101-RA 73..1128 17..1074 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:33 Download gff for BO27565.complete
Subject Subject Range Query Range Percent Splice Strand
CG7101-RA 73..1128 17..1074 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:33 Download gff for BO27565.complete
Subject Subject Range Query Range Percent Splice Strand
X 18831223..18831797 498..1074 99   Plus
X 18830663..18831143 17..497 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:00 Download gff for BO27565.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18725256..18725830 498..1074 99   Plus
arm_X 18724696..18725176 17..497 100 -> Plus

BO27565.pep Sequence

Translation from 16 to 1090

> BO27565.pep
MEPVPIRPKAPGASNRGALPLAAKKPAKKRTYHCGVCFAEFSRHLAAKRH
EQQCSVRVRRLFVCPHCLTLFGEEARLERHRERKHNDGQFLCLQCGKKYA
SATFLYRHVASWHGQQSLFYCDMCTDNCNDVKTFSGMLELQEHAEEVHRL
RTLKSTASDADSQVDEMEDLEMLEENIENILPSIDWDDDLTFGWPTDLDK
ESCIVNAKPSVFVCPFCANGFPGSLSLVRHLEQVHERSALDCCYCGKSHG
SREALRSHLQRVHILLRGHVCGICQADFATADHLKKHVNSLHLDHRPHLC
PTCGKRFTQRCHLTDHIKTDRGHGHGTYTCEFCVRPFFRAIDLERHVCEE
HPASFLDH

BO27565.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG7101-PA 352 CG7101-PA 1..352 1..352 1959 100 Plus
crol-PG 878 CG14938-PG 244..552 27..351 266 25 Plus
crol-PF 907 CG14938-PF 244..549 27..347 266 25.5 Plus
crol-PD 878 CG14938-PD 244..520 27..347 261 25.7 Plus
CG5245-PA 501 CG5245-PA 105..410 27..351 248 25.5 Plus
crol-PF 907 CG14938-PF 287..675 14..356 223 21.1 Plus
crol-PG 878 CG14938-PG 277..646 32..356 221 21.8 Plus
crol-PD 878 CG14938-PD 277..646 32..356 218 21.5 Plus
crol-PG 878 CG14938-PG 222..492 63..347 212 25.1 Plus
crol-PD 878 CG14938-PD 222..492 63..347 196 23.7 Plus