Clone BO27566 Report

Search the DGRC for BO27566

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptRgl-RB
Protein status:BO27566.pep: Imported from assembly
Sequenced Size:2356

Clone Sequence Records

BO27566.complete Sequence

2356 bp assembled on 2010-09-13

GenBank Submission: KX799967

> BO27566.complete
GAAGTTATCAGTCGACATGAGTCAAAATGTGGCCGACAGTTTGCCCACGT
GGCGCCTTTGGGGCGAAGAGCACGAGAAGAATGCAATTTTCACCGTTTAC
CTGAAGAAAGTGCGATACCACCGACCGACGCCCACAGCCAGCAATGACTC
AGATGATGAGATTTCCCATCTGGAGTGGGAGACTGTACGCGTGCGTTTCG
TTAAGGCGGCTACATTGGCTCGATTGGTGGAGGCGTTAGCCACCGACGAC
GGCGAGCTGGAGTCCACCTTCATCAACGTGTTCCTGTCCACATATCGCAC
CTTCTCCACACCCAAGCAGGTGCTCAGTCTGCTGACGCAACGGTACGATG
CTCTGCATGAGAAGCACCTGGAGGAGTTGGAGCAGGCACAGCAAAATGGA
CAGGTCATGGATCCCGCCTACGATCCACACGCCTCCATTCACGAGCAGCA
CAAGAAAACCCTAGTCTCAGCGCTGCACGTCTGGCTGGATGGATTCCCGG
AGGATTGGCACGAGGATAACCTGCAACAGATCTTGGCATTTGCCACCAAG
CGGCTGAAACGATCCGATCTGCACATCAAGGTGCTGAATCGTCTGGAACG
GCTCATCAAACAGTCTCTCTATGGAAATGGAGGAGGAAGCGGTGGCTCGG
AGAACAATGGTCATTCGTGGCTTTCCGCAGCGCGCTCACAACAGATGCAG
CAATTCATGATTCCCACTCACTATGGCTCTTCGTATGACCTCACGGATCA
GTTCAATGGCATGTACCTCTCGCCAATGGGCCACGGGCCCATCTATCGTG
GACCTACCCACTTTCTGCAGGCATTCCGTTTTCCGCATGTGCCCGTCCGG
CATTTTGCTGAGCAGTTGACCCGTATGGATACGGAACTCTTTAAGCGACT
GATTCCCCACCAGTGCCTCGGACACACGTGGGCACGACGTGATAGTGGAG
GATCCGAGACTGTGGTGGCCACCATCAACCAGTTTAATGCAGTGCTCTTC
CGGGTGGTGTCCAGTATCCTGATCGATCGCCTGAAACCTCAGGAGCGCGC
TCTGAACATTTCACGATGGATTGATATTGCCCAAGAGTTGCGCATGCTCA
AAAACTTTAGTTCGCTCAAGGCCATCATTTCGGCTCTAAACTCCAATTCA
ATATACCGCCTCTCCAAGATCTGGGAAGTGCTGCCTAAAGAAAGGATGGA
AGTCTTTACGGAGCTGGCGAATATTTGCTCGGAGGATAACAATGCTTGGA
CTCTGCGAGAAGTGTTGAAACGAGAAGGAACGGCCAAAAATCCAGATCCA
GGCAGTGATCACAGCGATAGGCATCTGCAGAAGCTTATTCTGAATTTGGG
AACACAAACATCGCATGGAACGATACCCTATTTGGGTACATTCCTTACCG
ACCTGACCATGATCCATACGGCCAATCCGGACTACCTCACCGAGAATAAG
CTCATAAACTTCGACAAGAAGCGCAAGGAGTTCGAAGTTCTGGCCCAGAT
CAAGTTACTTCAGGGAGCAGCTAACACATATAATCTCCAGGCGGATGCGC
TCTTTGATCATTGGTTCAACTCAATGCCAGTGTTTGATGAGCGTGAAGCC
TTTGAGCTGAGTTGTCGACTGGAACCACCACCGCCGGCGCCACGGAAATC
GGTGGTCAGCACTAACACCTCTTTAACAAACACGACCGCCTCATCGACGG
CTTCTATTATGGGCCACCGCAAGACTGACTCCATACACTCGAATTCGAGC
AGCGGAGCGGGATCACAGTTCTACTGCGAACTAAACAGTAGTACCAGCTC
CAGACATAACTCCTTGGATCGGGATGTCCACCATCAGCACGCCTCCTTGA
TGTCCGCCTCGAGTAGTGTGTCCAATCTGTCGTTGGACTCCAGTAACTCC
GGCGGTCGGCAGTCCGGCAAGCTGACCCACTCTCAGTCTATGGGAAATGG
TCTGAAATCTCACGGAAATGGCACTACGAATGGTGGATCGCCCCATATCA
ATGCTCAGTTGGTGCAACCATCAAGTGGAACCCCTCACTCTGCTCCCGAT
TTCTATATCATTCGGGTGACCTATGAAACAGACAACATCGAGCTGGATGG
GATTGTGCTGTACAAGAGTATTATGCTGGGAAATAACGAGCGCACGCCGC
AGGTTATCCGAAATGCGATGCTTAAATTGGGTCTGGAGGATGATCCGGAT
AGGTTTACTTTGGCGCAGGTCCTACCCGATAAGGAACTGGTGATGCCGAA
GAATGCGAATGTCTACTACGCGGTTAACACAAACTACAACCTCAACTTCA
TCCTAAGACCGCGAAAGGAAGAGGGTGTGGCAGGAAGCGCAAGCTTTCTA
GACCAT

BO27566.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
Rgl-RC 2325 CG8865-PC 1..2322 17..2338 11595 100 Plus
Rgl-RD 2325 CG8865-PD 1..2322 17..2338 11595 100 Plus
Rgl-RB 2325 CG8865-PB 1..2322 17..2338 11595 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
Rgl-RC 3754 CG8865-RC 503..2824 17..2338 11595 100 Plus
Rgl-RD 3865 CG8865-RD 614..2935 17..2338 11595 100 Plus
Rgl-RB 3939 CG8865-RB 688..3009 17..2338 11595 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13907827..13908970 2338..1195 5705 99.9 Minus
3L 28110227 3L 13909255..13909772 1043..526 2590 100 Minus
3L 28110227 3L 13909832..13910215 529..146 1920 100 Minus
3L 28110227 3L 13909031..13909186 1195..1040 780 100 Minus
3L 28110227 3L 13910483..13910586 146..43 520 100 Minus
Blast to na_te.dros performed on 2014-11-28 05:10:08 has no hits.

BO27566.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:41 Download gff for BO27566.complete
Subject Subject Range Query Range Percent Splice Strand
Rgl-RC 503..2824 17..2340 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:29 Download gff for BO27566.complete
Subject Subject Range Query Range Percent Splice Strand
Rgl-RB 688..3009 17..2340 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:05:19 Download gff for BO27566.complete
Subject Subject Range Query Range Percent Splice Strand
Rgl-RB 688..3009 17..2340 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:05:19 Download gff for BO27566.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13921699..13921725 17..43 100   Minus
3L 13910484..13910585 44..145 100 <- Minus
3L 13909832..13910215 146..529 100 <- Minus
3L 13909256..13909768 530..1042 100 <- Minus
3L 13909031..13909183 1043..1195 100 <- Minus
3L 13907825..13908969 1196..2340 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:29 Download gff for BO27566.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13914799..13914825 17..43 100   Minus
arm_3L 13903584..13903685 44..145 100 <- Minus
arm_3L 13902932..13903315 146..529 100 <- Minus
arm_3L 13902356..13902868 530..1042 100 <- Minus
arm_3L 13902131..13902283 1043..1195 100 <- Minus
arm_3L 13900925..13902069 1196..2340 99 <- Minus

BO27566.pep Sequence

Translation from 16 to 2356

> BO27566.pep
MSQNVADSLPTWRLWGEEHEKNAIFTVYLKKVRYHRPTPTASNDSDDEIS
HLEWETVRVRFVKAATLARLVEALATDDGELESTFINVFLSTYRTFSTPK
QVLSLLTQRYDALHEKHLEELEQAQQNGQVMDPAYDPHASIHEQHKKTLV
SALHVWLDGFPEDWHEDNLQQILAFATKRLKRSDLHIKVLNRLERLIKQS
LYGNGGGSGGSENNGHSWLSAARSQQMQQFMIPTHYGSSYDLTDQFNGMY
LSPMGHGPIYRGPTHFLQAFRFPHVPVRHFAEQLTRMDTELFKRLIPHQC
LGHTWARRDSGGSETVVATINQFNAVLFRVVSSILIDRLKPQERALNISR
WIDIAQELRMLKNFSSLKAIISALNSNSIYRLSKIWEVLPKERMEVFTEL
ANICSEDNNAWTLREVLKREGTAKNPDPGSDHSDRHLQKLILNLGTQTSH
GTIPYLGTFLTDLTMIHTANPDYLTENKLINFDKKRKEFEVLAQIKLLQG
AANTYNLQADALFDHWFNSMPVFDEREAFELSCRLEPPPPAPRKSVVSTN
TSLTNTTASSTASIMGHRKTDSIHSNSSSGAGSQFYCELNSSTSSRHNSL
DRDVHHQHASLMSASSSVSNLSLDSSNSGGRQSGKLTHSQSMGNGLKSHG
NGTTNGGSPHINAQLVQPSSGTPHSAPDFYIIRVTYETDNIELDGIVLYK
SIMLGNNERTPQVIRNAMLKLGLEDDPDRFTLAQVLPDKELVMPKNANVY
YAVNTNYNLNFILRPRKEEGVAGSASFLDH

BO27566.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
Rgl-PC 774 CG8865-PC 1..774 1..774 4046 100 Plus
Rgl-PD 774 CG8865-PD 1..774 1..774 4046 100 Plus
Rgl-PB 774 CG8865-PB 1..774 1..774 4046 100 Plus
Rgl-PE 973 CG8865-PE 182..956 2..776 4010 99 Plus
Rgl-PA 954 CG8865-PA 182..954 2..774 4007 99.1 Plus