Clone BO27569 Report

Search the DGRC for BO27569

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:69
Vector:pDNR-Dual
Associated Gene/Transcriptl(2)gl-RB
Protein status:BO27569.pep: Imported from assembly
Sequenced Size:3493

Clone Sequence Records

BO27569.complete Sequence

3493 bp assembled on 2010-09-13

GenBank Submission: KX794904

> BO27569.complete
GAAGTTATCAGTCGACATGTTAAAGTTTATCAGAGGAAAAGGGCAGCAGC
CCAGTGCTGACAGACAACGCTACATCACGGCACAGCATGGCTTTCCTCAT
AAGCCTTCGGCTCTTGCGTATGATCCAGTTTTGAAACTTATGGCAATAGG
GACGCAAACAGGGGCTTTAAAAGTTTTCGGTCAACCCGGAGTTGAATTGT
ACGGTCAGCATACTTTGTTAAACAATTCAGCATCGGAGCTTAATGTACAA
TTACTTGAATGGGTGTATGGAACTGGTCGCATACTTTCGTTGACGGCAGC
GAATCAATTAATTCTATGGGAGCCAGTTGGAGCAACGTTGCTGCCAATCA
AAACACTACCGTTTGACGGCAAACTTAAAAAAGTTTCATCGCTGTGCTGT
TCTCTCAGTAAGGATCTGCTATGGATTGGAACAGAAGGTGGAAACATCTA
TCAACTGGATTTACATACATTTACCATTAAGGAGCCTGTAATTTACCATG
ACGTTGTGCTAGAGCAGGTGCCACCAGCCTACAAGCTAAATCCTGGTGCA
ATTGAGTCAATCCGCCAACTTCCAAACTCCCCTAGCAAACTTCTAGTTGC
ATACAATCGCGGCCTTTGTGTTTTGTGGGATTTTGAAAGCGCATCTGTCC
AGCGAGCATACATAGCCCCTGGACATGGACAGAGCGTTGGTCTTACAGTG
AACTTCGAAGGATCTGAATTTACCTGGTACCACGCTGATGGTTCATACGC
CACTTGGAGCATAGATAACCCAGAACCGCCGTCGAATGTTAATTATGTGC
CTTATGGACCTGATCCATGCAAAAGCATAAATCGACTGTACAAAGGCAAG
CGAAGATCCAACGATGTAATTGTTTTTTCCGGCGGCATGCCACGGTCAGC
ATATGGTGATCACAATTGTGTGTCCGTTCACGCCAGCGATGGACACAAAG
TGTGTCTTGACTTTACGTCTAAAGTGATTGACTTTTTTGTGACCTTTGAA
AATAATAGAGATGTCGCTGAAGTTCTTGTTGTACTACTTGAAGAGGAACT
CTGCGCTTACGATCTTACTGACCCTAATATTTGTGCTATCAAAGCGCCAT
ATCTTCACTCTGTCCATGCATCAGCTGTCACTTGCAATTACCTTGCTTCT
GAAGTCGTACAGTCGGTATATGAAAGTATTTTAAGAGCTGGAGATGAACA
AGACATTGACTATAGCAATATTAGCTGGCCTATCACTGGCGGTACTCTCC
CGGATAACTTAGAAGAATCTGTAGAAGAGGACGCGACTAAGCTTTATGAG
ATTTTGTTAACTGGTCACGAAGATGGTTCTGTTAAATTTTGGGACTGCAC
TGGAGTGTTGCTTAAACCAATTTATAATTTTAAAACTAGCAGCATTTTTG
GAAGTGAGTCAGACTTCCGAGATGACGCAGCTGCAGATATGAGTGCGGAA
CAAGTCGATGAAGGAGAACCGCCATTTCGGAAATCAGGACTTTTTGATCC
TTATTCAGATGACCCTCGTTTAGCAGTGAAGAAAATAGCATTCTGCCCAA
AAACCGGACAACTTATTGTTGGTGGCACAGCGGGCCAAATAGTTATAGCC
GACTTCATAGACTTACCCGAAAAAGTGTCTTTAAAATACATTTCAATGAA
TTTGGTCAGCGATCGTGATGGATTTGTGTGGAAGGGTCACGATCAGTTAA
ACGTGCGATCGAACTTATTAGACGGAGAAGCAATTCCTACGACGGAACGT
GGTGTAAATATATCGGGAGTACTGCAAGTTTTGCCGCCAGCCAGCATAAC
ATGCATGGCACTCGAAGCAAGCTGGGGCCTAGTATCTGGTGGGACTGCGC
ACGGCTTAGTTCTCTTTGACTTCAAAAACTTTGTTCCAGTATTTCATCGC
TGCACTTTAAACCCAAATGATCTTACTGGAGCAGGAGAGCAGCTGTCTCG
TCGAAAGTCTTTTAAGAAATCATTGAGGGAGTCATTTAGAAAGCTTCGCA
AGGGTCGATCGACCAGGACCAACCAGAGCAATCAAGTACCAACAACGCTG
GAAGCAAGACCCGTCGAGAGGCAAATAGAGGCTCGTTGTGCAGATGACGG
GCTAGGATCCATGGTGCGATGTTTACTATTTGCCAAAACTTATGTTACTA
ATGTCAACATAACGTCGCCAACTTTGTGGTCAGCAACAAATGCCAGTACA
GTCTCGGTTTTCCTTCTGCATTTGCCACCAGCGCAGACCGCGGCAACTGC
CGTCCCGTCGGCAAGTGGCAATGCACCACCACACATGCCCCGCCGAATTT
CTGCGCAGCTTGCTAAAGAAATACAATTAAAACATCGTGCTCCTGTGGTG
GGTATTTCTATTTTTGATCAGGCGGGTAGCCCTGTCGATCAGCTGAACGC
CGGTGAAAACGGGAGTCCACCGCATCGTGTACTTATTGCTTCCGAGGAAC
AGTTCAAGGTGTTTTCACTTCCGCAACTAAAGCCGATTAACAAATATAAG
CTTACCGCTAACGAAGGTGCTCGGATTCGCCGCATCCATTTTGGTTCGTT
TAGTTGTCGCATATCCCCGGAAACACTGCAGAGTATGCACGGTTGTAGCC
CAACTAAGTCCACGCGTTCACATGGCGATGGAGAGGCGGATCCTAATATC
AGTGGAAGCTTGGCTGTAAGTCGTGGAGATGTATATAACGAAACAGCATT
GATATGTTTAACGAATATGGGCGATATCATGGTTTTATCAGTACCTGAAT
TAAAAAGACAGCTGAATGCCGCAGCAGTGCGACGGGAAGACATTAATGGA
GTTTCGTCACTTTGCTTTACAAACTCTGGAGAAGCACTGTATATGATGTC
TTCTTCTGAACTGCAGCGTATTGCTTTAGCCACGTCCAGAGTCGTGCAAC
CCACTGGCGTTGTTCCAGTAGAACCATTAGAAAATGAAGAGTCTGTGTTG
GAAGAAAATGATGCAGAGAATAATAAGGAAACCTACGCATGTGATGAAGT
TGTGAATACATATGAAATTAAAAATCCATCAGGCATTTCAATATGCACAA
GGCCTGCAGAGGAAAACGTTGGAAGAAATAGTGTTCAGCAAGTTAATGGA
GTCAACATTTCAAATTCACCTAATCAAGCTAACGAGACTATCAGCAGCTC
TATTGGCGATATTACCGTTGACTCGGTGCGCGACCATTTAAATATGACGA
CCACCACTTTGTGTTCTATTAATACAGAGGAAACCATTGGTCGCCTATCT
GTACTTAGCACGCAAACCAACAAAGCCAGTACTACCGTAAACATGAGTGA
AATTCCAAATATTAATATTTCTAATTTAGAGGACTTGGAATCGAAAAGAA
ATACGACGGAAACGAGTACTAGTTCTGTTGTAATTAAATCTATAATTACA
AACATTTCTCATGAAAAAACGAACGGAGACAACAAAATAGGAACGCCAAA
AACAGCGCCTGAAGAAAGCCAATTTGCAAGCTTTCTAGACCAT

BO27569.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:14:28
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)gl-RB 3462 CG2671-PB 1..3459 17..3475 17295 100 Plus
l(2)gl-RJ 3486 CG2671-PJ 85..3483 77..3475 16995 100 Plus
l(2)gl-RI 3486 CG2671-PI 85..3483 77..3475 16995 100 Plus
l(2)gl-RJ 3486 CG2671-PJ 1..54 17..70 255 98.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)gl-RB 5155 CG2671-RB 317..3776 16..3475 17300 100 Plus
l(2)gl-RF 5082 CG2671-RF 239..3703 16..3475 17215 99.9 Plus
l(2)gl-RE 5225 CG2671-RE 382..3846 16..3475 17215 99.9 Plus
l(2)gl-RB 5155 CG2671-RB 3823..3928 3347..3452 365 89.6 Plus
l(2)gl-RF 5082 CG2671-RF 3750..3855 3347..3452 365 89.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13683..14876 2047..854 5970 100 Minus
2L 23513712 2L 14933..15711 855..77 3895 100 Minus
2L 23513712 2L 12286..12929 2796..2153 3220 100 Minus
2L 23513712 2L 11777..12221 3241..2797 2225 100 Minus
2L 23513712 2L 11218..11346 3475..3347 645 100 Minus
2L 23513712 2L 11410..11519 3348..3239 550 100 Minus
2L 23513712 2L 13520..13626 2153..2047 535 100 Minus
2L 23513712 2L 11066..11171 3452..3347 365 89.6 Minus
2L 23513712 2L 19885..19945 76..16 305 100 Minus
2L 23513712 2L 17083..17136 70..17 255 98.1 Minus
Blast to na_te.dros performed on 2014-11-28 05:14:27 has no hits.

BO27569.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:46 Download gff for BO27569.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)gl-RB 319..3772 22..3477 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:43 Download gff for BO27569.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)gl-RB 323..3776 22..3477 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:06:47 Download gff for BO27569.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)gl-RB 323..3776 22..3477 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:06:47 Download gff for BO27569.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17075..17131 22..76 91   Minus
2L 14933..15711 77..855 100 <- Minus
2L 13683..14874 856..2047 100 <- Minus
2L 13520..13625 2048..2153 100 <- Minus
2L 12286..12928 2154..2796 100 <- Minus
2L 11779..12221 2797..3239 100 <- Minus
2L 11410..11518 3240..3348 100 <- Minus
2L 11216..11344 3349..3477 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:43 Download gff for BO27569.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17075..17131 22..76 91   Minus
arm_2L 14933..15711 77..855 100 <- Minus
arm_2L 13683..14874 856..2047 100 <- Minus
arm_2L 13520..13625 2048..2153 100 <- Minus
arm_2L 12286..12928 2154..2796 100 <- Minus
arm_2L 11779..12221 2797..3239 100 <- Minus
arm_2L 11410..11518 3240..3348 100 <- Minus
arm_2L 11216..11344 3349..3477 98 <- Minus

BO27569.pep Sequence

Translation from 16 to 3493

> BO27569.pep
MLKFIRGKGQQPSADRQRYITAQHGFPHKPSALAYDPVLKLMAIGTQTGA
LKVFGQPGVELYGQHTLLNNSASELNVQLLEWVYGTGRILSLTAANQLIL
WEPVGATLLPIKTLPFDGKLKKVSSLCCSLSKDLLWIGTEGGNIYQLDLH
TFTIKEPVIYHDVVLEQVPPAYKLNPGAIESIRQLPNSPSKLLVAYNRGL
CVLWDFESASVQRAYIAPGHGQSVGLTVNFEGSEFTWYHADGSYATWSID
NPEPPSNVNYVPYGPDPCKSINRLYKGKRRSNDVIVFSGGMPRSAYGDHN
CVSVHASDGHKVCLDFTSKVIDFFVTFENNRDVAEVLVVLLEEELCAYDL
TDPNICAIKAPYLHSVHASAVTCNYLASEVVQSVYESILRAGDEQDIDYS
NISWPITGGTLPDNLEESVEEDATKLYEILLTGHEDGSVKFWDCTGVLLK
PIYNFKTSSIFGSESDFRDDAAADMSAEQVDEGEPPFRKSGLFDPYSDDP
RLAVKKIAFCPKTGQLIVGGTAGQIVIADFIDLPEKVSLKYISMNLVSDR
DGFVWKGHDQLNVRSNLLDGEAIPTTERGVNISGVLQVLPPASITCMALE
ASWGLVSGGTAHGLVLFDFKNFVPVFHRCTLNPNDLTGAGEQLSRRKSFK
KSLRESFRKLRKGRSTRTNQSNQVPTTLEARPVERQIEARCADDGLGSMV
RCLLFAKTYVTNVNITSPTLWSATNASTVSVFLLHLPPAQTAATAVPSAS
GNAPPHMPRRISAQLAKEIQLKHRAPVVGISIFDQAGSPVDQLNAGENGS
PPHRVLIASEEQFKVFSLPQLKPINKYKLTANEGARIRRIHFGSFSCRIS
PETLQSMHGCSPTKSTRSHGDGEADPNISGSLAVSRGDVYNETALICLTN
MGDIMVLSVPELKRQLNAAAVRREDINGVSSLCFTNSGEALYMMSSSELQ
RIALATSRVVQPTGVVPVEPLENEESVLEENDAENNKETYACDEVVNTYE
IKNPSGISICTRPAEENVGRNSVQQVNGVNISNSPNQANETISSSIGDIT
VDSVRDHLNMTTTTLCSINTEETIGRLSVLSTQTNKASTTVNMSEIPNIN
ISNLEDLESKRNTTETSTSSVVIKSIITNISHEKTNGDNKIGTPKTAPEE
SQFASFLDH

BO27569.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)gl-PB 1153 CG2671-PB 1..1153 1..1153 5978 100 Plus
l(2)gl-PJ 1161 CG2671-PJ 1..1161 1..1153 5939 99.1 Plus
l(2)gl-PI 1161 CG2671-PI 1..1161 1..1153 5939 99.1 Plus
l(2)gl-PH 1161 CG2671-PH 1..1161 1..1153 5939 99.1 Plus
l(2)gl-PG 1161 CG2671-PG 1..1161 1..1153 5939 99.1 Plus