Clone BO27574 Report

Search the DGRC for BO27574

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:74
Vector:pDNR-Dual
Associated Gene/Transcriptnuf-RD
Protein status:BO27574.pep: Imported from assembly
Sequenced Size:982

Clone Sequence Records

BO27574.complete Sequence

982 bp assembled on 2010-08-18

GenBank Submission: KX796087

> BO27574.complete
GAAGTTATCAGTCGACATGTATGTGAAATATCCCATGGCTGAGGTGCAGT
TGGTGAACGATCTTCTCCTCGATCTGCGGCACATGAAAAAAGATTGTCTG
GAACTGCTGCAGCGCAAGGTGGACGATCTGTCAGATACACAGAATATAGC
TGAGGATCGGACAACCCGCACCAAGACCGAATATGCAGTCCTTCAGGCGC
GTTATCACATGCTCGAAGAGCAGTACCGAGAGTCGGAACTGCGTGCCGAG
GAGCGTTTGGCAGAGGAGCAGAAGCGGCACCGCGAGATTTTGGCCCGCGT
GGAGCGTGAAGCCTCGCTGCAGAACGAGAACTGCCAGATGAAGATCCGTG
CCACCGAGATCGAGGCAACGGCACTGCGGGAAGAAGCCGCCCGACTGCGT
GTCCTGTGTGACAAGCAGGCCAATGACCTCCATCGCACCGAGGAACAGTT
GGAGCTGGCGCGCGACCAAATCGGCGTCCTGCAACAGGAGCACGAGGAGC
AGGCACAGGCACTGCGCCGCCACGAACAGGAGAAGAAGTCCACCGAGGAG
CTGATGCTGGAGCTGGGCCGGGAACTGCAGCGTGCTCGCGAGGAGAGTGG
AGCCCGGGCAATGCCGACCACATCGCCGGAGAGCATAAGACTGGAGGAGC
TGCATCAGGAGCTCGAGGAGATGCGCCAGAAGAACCGAACCCTCGAAGAA
CAGAACGAGGAGCTGCAGGCCACGATGCTGACCAACCAGGCCACCATGCT
GACAAATGGCGTGGAGCAGGGTCGCCATCTGCTGAACGGAACACTCAACA
GTTTGGCTCAGGAGCTCGAGGAGATGTCACAAGCCCAGCTACAACAGGCC
TTCCAGGAAAAGGAGGATGAAAATGTTCGGCTTAAGCACTATATTGATAC
CATTCTACTCAACATCGTGGAGAACTATCCTCAATTGCTGGAAGTCAAGC
CCATGGAGCGAAAGGCAAGCTTTCTAGACCAT

BO27574.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
nuf-RD 951 CG33991-PD 1..948 17..964 4740 100 Plus
nuf-RF 1587 CG33991-PF 718..1584 98..964 4335 100 Plus
nuf-RE 1587 CG33991-PE 718..1584 98..964 4335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:44:41
Subject Length Description Subject Range Query Range Score Percent Strand
nuf-RD 2448 CG33991-RD 303..1250 17..964 4740 100 Plus
nuf-RF 3099 CG33991-RF 1035..1901 98..964 4335 100 Plus
nuf-RE 3233 CG33991-RE 1169..2035 98..964 4335 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14230654..14231112 231..689 2295 100 Plus
3L 28110227 3L 14231177..14231325 690..838 745 100 Plus
3L 28110227 3L 14230176..14230310 98..232 675 100 Plus
3L 28110227 3L 14231924..14232052 836..964 645 100 Plus
3L 28110227 3L 14230026..14230106 17..97 405 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:44:38 has no hits.

BO27574.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:42 Download gff for BO27574.complete
Subject Subject Range Query Range Percent Splice Strand
nuf-RD 301..1248 17..966 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:55 Download gff for BO27574.complete
Subject Subject Range Query Range Percent Splice Strand
nuf-RD 303..1250 17..966 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:29 Download gff for BO27574.complete
Subject Subject Range Query Range Percent Splice Strand
nuf-RD 303..1250 17..966 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:29 Download gff for BO27574.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14231927..14232052 839..966 98   Plus
3L 14231177..14231325 690..838 100 -> Plus
3L 14230656..14231112 233..689 100 -> Plus
3L 14230176..14230310 98..232 100 -> Plus
3L 14230026..14230106 17..97 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:55 Download gff for BO27574.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14225027..14225152 839..966 98   Plus
arm_3L 14224277..14224425 690..838 100 -> Plus
arm_3L 14223756..14224212 233..689 100 -> Plus
arm_3L 14223276..14223410 98..232 100 -> Plus
arm_3L 14223126..14223206 17..97 100 -> Plus

BO27574.pep Sequence

Translation from 16 to 982

> BO27574.pep
MYVKYPMAEVQLVNDLLLDLRHMKKDCLELLQRKVDDLSDTQNIAEDRTT
RTKTEYAVLQARYHMLEEQYRESELRAEERLAEEQKRHREILARVEREAS
LQNENCQMKIRATEIEATALREEAARLRVLCDKQANDLHRTEEQLELARD
QIGVLQQEHEEQAQALRRHEQEKKSTEELMLELGRELQRAREESGARAMP
TTSPESIRLEELHQELEEMRQKNRTLEEQNEELQATMLTNQATMLTNGVE
QGRHLLNGTLNSLAQELEEMSQAQLQQAFQEKEDENVRLKHYIDTILLNI
VENYPQLLEVKPMERKASFLDH

BO27574.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
nuf-PD 316 CG33991-PD 1..316 1..316 1576 100 Plus
nuf-PB 305 CG33991-PB 1..305 12..316 1445 96.1 Plus
nuf-PA 502 CG33991-PA 198..502 12..316 1445 96.1 Plus
nuf-PC 502 CG33991-PC 198..502 12..316 1445 96.1 Plus
nuf-PM 318 CG33991-PM 1..318 12..316 1421 92.1 Plus