Clone BO27575 Report

Search the DGRC for BO27575

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptRtnl1-RC
Protein status:BO27575.pep: Imported from assembly
Sequenced Size:640

Clone Sequence Records

BO27575.complete Sequence

640 bp assembled on 2010-08-18

GenBank Submission: KX796788

> BO27575.complete
GAAGTTATCAGTCGACATGTCGAACAGATTGTTGGAATCCCTTATCTACT
GGCGCGATGTGAAGAAATCCGGCATTGTCTTCGGCGCTGGCCTGATCACA
CTGGCGGCCATCTCCAGCTTCTCGGTGATCAGCGTGTTCGCCTACTTGTC
GCTCCTAACCCTCTTCGGCACCGTCGCCTTCAGAATCTACAAATCTGTGA
CACAGGCCGTGCAAAAGACAAACGAGGGTCACCCCTTTAAGGATTACCTG
GAGCTGGATCTGACGCTGTCGCACGAAAAGGTACAGAACATTGCCGGCGT
GGCTGTGGCACATATCAATGGCTTCATCTCCGAGCTGAGGCGTCTGTTTC
TTGTTGAGGATATCATCGATTCGATCAAGTTCGGCGTCATTCTGTGGGTC
TTCACCTACGTGGGTGCCTGGTTCAATGGCATGACTCTGGTCATCTTGGC
CTTTGTCTCGCTGTTTACCTTGCCCAAGGTCTACGAGAACAACAAGCAAT
CGATCGACACTCACTTGGATCTGGTGCGCAGCAAATTGACAGAAATCACC
GACAAGATCCGAGTGGCCATCCCCATTGGCAACAAGAAGCCCGAGGCCGC
TGCCGAGTCTGAGAAGGACAAGGCAAGCTTTCTAGACCAT

BO27575.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl1-RC 609 CG33113-PC 1..606 17..622 3030 100 Plus
Rtnl1-RF 1788 CG33113-PF 1190..1785 27..622 2965 99.8 Plus
Rtnl1-RG 675 CG33113-PG 81..672 31..622 2960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl1-RC 1267 CG33113-RC 92..697 17..622 3030 100 Plus
Rtnl1-RF 2700 CG33113-RF 1535..2130 27..622 2965 99.8 Plus
Rtnl1-RG 2271 CG33113-RG 277..868 31..622 2960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4994508..4994716 449..241 1045 100 Minus
2L 23513712 2L 4994786..4994994 241..33 1045 100 Minus
2L 23513712 2L 4994338..4994445 556..449 540 100 Minus
2L 23513712 2L 4994211..4994277 622..556 335 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:39:24 has no hits.

BO27575.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:22 Download gff for BO27575.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RC 68..673 17..624 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:02 Download gff for BO27575.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RC 92..697 17..624 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:15:52 Download gff for BO27575.complete
Subject Subject Range Query Range Percent Splice Strand
Rtnl1-RC 92..697 17..624 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:15:52 Download gff for BO27575.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4995376..4995391 17..32 100   Minus
2L 4994787..4994994 33..240 100 <- Minus
2L 4994508..4994716 241..449 100 <- Minus
2L 4994339..4994444 450..555 100 <- Minus
2L 4994209..4994277 556..624 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:02 Download gff for BO27575.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4995376..4995391 17..32 100   Minus
arm_2L 4994787..4994994 33..240 100 <- Minus
arm_2L 4994508..4994716 241..449 100 <- Minus
arm_2L 4994339..4994444 450..555 100 <- Minus
arm_2L 4994209..4994277 556..624 97 <- Minus

BO27575.pep Sequence

Translation from 16 to 640

> BO27575.pep
MSNRLLESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLF
GTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHI
NGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLF
TLPKVYENNKQSIDTHLDLVRSKLTEITDKIRVAIPIGNKKPEAAAESEK
DKASFLDH

BO27575.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
Rtnl1-PC 202 CG33113-PC 1..202 1..202 1008 100 Plus
Rtnl1-PG 224 CG33113-PG 23..224 1..202 985 97.5 Plus
Rtnl1-PD 224 CG33113-PD 23..224 1..202 985 97.5 Plus
Rtnl1-PL 222 CG33113-PL 26..222 6..202 982 99.5 Plus
Rtnl1-PA 222 CG33113-PA 26..222 6..202 981 99.5 Plus