Clone BO27576 Report

Search the DGRC for BO27576

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:76
Vector:pDNR-Dual
Associated Gene/TranscriptCG32473-RB
Protein status:BO27576.pep: Imported from assembly
Sequenced Size:2743

Clone Sequence Records

BO27576.complete Sequence

2743 bp assembled on 2010-09-13

GenBank Submission: KX797230

> BO27576.complete
GAAGTTATCAGTCGACATGGCAACTGTGGCGCCCGCTGTAAAAGCCGCGA
GCAAGGTGCTCCAGAATCTGGGATTCCGGCTGCCCAAACAGATTAAGCCA
AGCAAGTACCGCCTTCATTTGCGCCCCGATCTCGAACGAAAGAACTATTC
CGGCAATATAAGCATCAGCCTGCAAGTACTGGAGCCCATAGCCTTCATCC
CAGTCCATGTGAAGCAACTGAATGTGAGCACCGTTGAGGTGAAGCGCCTG
GATGAATCTGGAGCGCCGCTTAAGGACATCACCCCCACGCTGACCTTTGC
CCATCCGGAGTTTGAGTACTGGGTGACCGAGTTCGAACAGCCGCTGGAGG
CGGGAAACTACTCACTGCTGCTCAACTTTACGGGATCGCTTGTAGATCGG
ATTACGGGGATGTACCAGAGCTCCTACTTGGATAAGCTGAAAAACCGCTC
CAGATCAATCATTTCCACAAAGTTTGAGCCCACTTATGCCCGCCAAGCAT
TCCCCTGCTTCGATGAGCCCGCCCTTAAGGCTCAGTTCACCATAACGGTG
GCCCGTCCAAGTGGTGATGAGTACCATGTGCTGTCCAACATGCCAGTGGC
CAGCGAGTATGTCGATGGCGATATCACCGAGGTGACTTTCGCGGAGACCG
TACCCATGAGCACCTATCTGGCCGCCTTTGTGGTGTCTGATTTTCAATAC
AAGGAAACCACTGTGGAGGGAACCAGCATCGCTCTGAAAGTCTATGCGCC
ACCAGCGCAGGTGGAGAAAACCCAGTACGCCCTGGACACTGCGGCCGGAG
TGATGGCCTACTACATCAACTATTTCAATGTTTCGTATGCCCTACCCAAA
TTGGATCTGGTTGCCATACCCGATTTCGTGTCCGGTGCTATGGAAAACTG
GGGATTGGTCACGTTCCGGGAGACGGCTCTTCTGTACGACGAATCTACCA
GTTCCAGCGTGAATAAGCAGCGTGTGGCCATCGTCGTGGCCCATGAGTTG
GCTCACCAGTGGTTCGGAAACCTGGTAACCATGAACTGGTGGAACGATTT
GTGGCTAAACGAGGGTTTCGCATCATTCCTTGAGTACAAGGGAGTAAAGC
AAATGCATCCGGAATGGGATATGGACAATCAGTTTGTTATTGAGGAACTG
CACCCGGTGCTGACCATTGATGCCACCTTAGCCTCCCATCCGATTGTCAA
GTCCATTGAGAGTCCAGCCGAGATCACGGAGTACTTCGATACCATCACCT
ATTCAAAGGGAGCCGCCTTAGTACGCATGCTTGAGAATCTGGTGGGCGAG
GAAAAGTTGAGGAACGCCACCACCCGCTATTTGGTGCGTCATATCTACAG
TACTGCCACCACCGAGGATTACCTCACCGCAGTCGAGGAGGAGGAGGGCC
TGGAATTTGACGTGAAGCAGATCATGCAGACCTGGACGGAGCAGATGGGT
CTTCCGGTTGTGGAGGTGGAGAAAAGTGGCAGTACTTATAAGCTCACCCA
AAAGCGTTTCCTGGCCAACGAAGATGACTACGCAGCCGAAGCTGAAGCAT
CGTCCTTCAACTACCGTTGGTCGATTCCCATTACCTACACGAGCAGCATC
AACAGTGAAGTCCAATCACTAATATTCAACCACAATGACAATGAGGCCAC
CATAACGCTTCCGGAAGAGGCCAGCTGGATTAAGATTAACACGAATCAAG
TGGGCTACTACCGGGTGAACTACGGCAGCGAACAGTGGGCGGAACTCATA
TCGGCCCTGAAGAACTCCCGGGAAACCTTCAGCACCGCCGATCGCGCTCA
TCTGCTGAACGATGCCAATACCCTGGCCGCTGCCGGACAGCTTAACTACT
CCGTGGCACTGGATCTGATATCTTACCTGGAGAGCGAGCAGGACTACGTG
CCCTGGAGCGTAGGCACCTCCGCCCTGGCTACGTTAAGGAACCGCGTATA
CTACACGGACTTGTACACTAATTACACCACCTACGCCCGTAAACTGCTTA
CGCCCATCGTAGAAAAGGTCACGTTTACCGTGGCAGCCGATCATCTGGAA
AATCGCCTCCGTATTAAGGTGCTGAGCTCAGCCTGCAGCTTGGGACATGA
GAGCTCCTTGCAACAGGCGGTCACGCTCTTCAACCAGTGGCTAGCCAGCC
CCGAGACCCGGCCCAATCCGGATATCCGAGACGTTGTCTACTACTATGGT
CTGCAACAGGTGAACACAGAGGCTGCCTGGGATCAAGTTTGGAAGCTGTA
TCTGGACGAGAGTGATGCCCAGGAAAAGCTGAAGTTGATGAACTGCCTAA
CCGCCGTGCAGGTGCCATGGCTGTTGCAGCGTTACATCAACTGGGCCTGG
GATGAGAGCAATGTCCGCCGCCAGGACTACTTCACCCTGCTTGGATATAT
ATCCACCAATCCGGTGGGTCAGAGTCTTGTGTGGGATTACGTGCGTGAAA
ACTGGGAGAAGTTGGTGGATCGTTTCGGCATCAATGAACGCACCTTGGGT
CGTCTGATCCCCACGATCACTGCCCGCTTCTCAACAGAAACCAAGCTGGA
AGAGATGCAGCAGTTCTTTGCCAAATATCCCGAGGCTGGAGCCGGAACTG
CGGCCCGTCAACAGGCGTTGGAAGCGGTGAAGGCAAACATCAAATGGCTA
GCGGCCAACAAGGCCCAGGTGGGCGAATGGTTGGCCAATTACGTTCAACA
GTCCAGCGTCACCAACCGCATTCAGGCAAGCTTTCTAGACCAT

BO27576.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-RB 2712 CG32473-PB 1..2709 17..2725 13545 100 Plus
CG32473-RC 3078 CG32473-PC 367..3075 17..2725 13545 100 Plus
CG32473-RA 3039 CG32473-PA 763..3036 452..2725 11370 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-RB 3002 CG32473-RB 134..2842 17..2725 13545 100 Plus
CG32473-RC 3635 CG32473-RC 767..3475 17..2725 13545 100 Plus
CG32473-RA 3273 CG32473-RA 840..3113 452..2725 11370 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13310143..13311109 451..1417 4835 100 Plus
3R 32079331 3R 13311953..13312625 2053..2725 3365 100 Plus
3R 32079331 3R 13311404..13311895 1561..2052 2460 100 Plus
3R 32079331 3R 13309519..13309955 17..453 2185 100 Plus
3R 32079331 3R 13311174..13311317 1417..1560 720 100 Plus
3R 32079331 3R 13313341..13313573 1050..1293 595 84.8 Plus
3R 32079331 3R 13313710..13313973 1561..1842 545 81.2 Plus
3R 32079331 3R 29247180..29247288 1071..963 320 86.2 Minus
3R 32079331 3R 13300347..13300431 987..1071 305 90.6 Plus
3R 32079331 3R 13297841..13298076 2372..2607 280 74.6 Plus
3R 32079331 3R 13295918..13296098 845..1025 245 75.7 Plus
3R 32079331 3R 29242633..29242712 1071..992 220 85 Minus
3R 32079331 3R 29236928..29237007 1065..986 205 83.8 Minus
3R 32079331 3R 29143469..29143569 965..1065 190 79.2 Plus
Blast to na_te.dros performed on 2014-11-28 05:04:37 has no hits.

BO27576.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:38 Download gff for BO27576.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RB 134..2842 17..2727 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:15 Download gff for BO27576.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RC 767..3475 17..2727 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:03:41 Download gff for BO27576.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RC 767..3475 17..2727 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:03:41 Download gff for BO27576.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13311953..13312625 2053..2727 99   Plus
3R 13311404..13311895 1561..2052 100 -> Plus
3R 13311174..13311317 1417..1560 100 -> Plus
3R 13310146..13311108 454..1416 100 -> Plus
3R 13309519..13309955 17..453 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:15 Download gff for BO27576.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9137675..9138347 2053..2727 99   Plus
arm_3R 9137126..9137617 1561..2052 100 -> Plus
arm_3R 9136896..9137039 1417..1560 100 -> Plus
arm_3R 9135868..9136830 454..1416 100 -> Plus
arm_3R 9135241..9135677 17..453 100 -> Plus

BO27576.pep Sequence

Translation from 16 to 2743

> BO27576.pep
MATVAPAVKAASKVLQNLGFRLPKQIKPSKYRLHLRPDLERKNYSGNISI
SLQVLEPIAFIPVHVKQLNVSTVEVKRLDESGAPLKDITPTLTFAHPEFE
YWVTEFEQPLEAGNYSLLLNFTGSLVDRITGMYQSSYLDKLKNRSRSIIS
TKFEPTYARQAFPCFDEPALKAQFTITVARPSGDEYHVLSNMPVASEYVD
GDITEVTFAETVPMSTYLAAFVVSDFQYKETTVEGTSIALKVYAPPAQVE
KTQYALDTAAGVMAYYINYFNVSYALPKLDLVAIPDFVSGAMENWGLVTF
RETALLYDESTSSSVNKQRVAIVVAHELAHQWFGNLVTMNWWNDLWLNEG
FASFLEYKGVKQMHPEWDMDNQFVIEELHPVLTIDATLASHPIVKSIESP
AEITEYFDTITYSKGAALVRMLENLVGEEKLRNATTRYLVRHIYSTATTE
DYLTAVEEEEGLEFDVKQIMQTWTEQMGLPVVEVEKSGSTYKLTQKRFLA
NEDDYAAEAEASSFNYRWSIPITYTSSINSEVQSLIFNHNDNEATITLPE
EASWIKINTNQVGYYRVNYGSEQWAELISALKNSRETFSTADRAHLLNDA
NTLAAAGQLNYSVALDLISYLESEQDYVPWSVGTSALATLRNRVYYTDLY
TNYTTYARKLLTPIVEKVTFTVAADHLENRLRIKVLSSACSLGHESSLQQ
AVTLFNQWLASPETRPNPDIRDVVYYYGLQQVNTEAAWDQVWKLYLDESD
AQEKLKLMNCLTAVQVPWLLQRYINWAWDESNVRRQDYFTLLGYISTNPV
GQSLVWDYVRENWEKLVDRFGINERTLGRLIPTITARFSTETKLEEMQQF
FAKYPEAGAGTAARQQALEAVKANIKWLAANKAQVGEWLANYVQQSSVTN
RIQASFLDH

BO27576.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-PB 903 CG32473-PB 1..903 1..903 4675 100 Plus
CG32473-PC 1025 CG32473-PC 123..1025 1..903 4675 100 Plus
CG32473-PA 1012 CG32473-PA 130..1012 16..903 4014 88.7 Plus
CG8773-PB 994 CG8773-PB 117..989 16..889 2581 56.4 Plus
CG8774-PB 885 CG8774-PB 9..885 20..902 2158 47.6 Plus