Clone BO27577 Report

Search the DGRC for BO27577

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCG6194-RA
Protein status:BO27577.pep: Imported from assembly
Sequenced Size:2038

Clone Sequence Records

BO27577.complete Sequence

2038 bp assembled on 2010-09-13

GenBank Submission: KX797622

> BO27577.complete
GAAGTTATCAGTCGACATGAACTATGACGGCCTCCTTTCCAAGTTGACCG
ACGAAAAACTGATGCTCTTCGAAGCCGCCGGCGAGGGGACCATTGTAGAG
GGTAGCCGGATATGCGGCCAGGATGCGGATCCGCTCTCCTTGCCGCTGGT
GGAGGACGGCGCCATCGAGGAGGAGCAGGCGGCCCCCATACAGACGATTC
ATCGCACTGTATTCGCCGTTCCACGCGTCCCTTCCCCCTCCCCCGTAAGC
ACATCAGGTGCCAATCTGAACCTCAAGACGGAAAACGCTGCGACAGCGAC
TCCGCAGCGCAAAATATCGACGTCATCACGTTTCATGAACGCCTTCAGTC
AGCTCTACGGCGGCGGCAACAGCGGTCCGAGCTGCGGTCACGTGGAGCAG
CACAACGAGGAACCCGGTGACCTGTCGGCAAACCGTACTCCCACCAAGGG
CATGGAGTCCAAGCTCGTCGCAATGTGGCACAATGTGAAGTATGGCTGGA
GCGGCAAGATGAGGCAGACCAGCTTCTCAAAGGAGCAGCCCGTGTGGCTG
CTAGGACGGTGCTATCATCGACGCTTTACTCCGCCCGTAAGCATGGAAAG
TTCCATCACCGAGCTGCCCAGCGGGGCGGATACCACCCCCGATAACGCCA
CATCGGCGTTCGACAGCATTCAGGCCACATCGACATCAACCTCCTTGTAT
CCAGCCCTTAATCCGCAGCAGATCGATGAGATTGTGGTGCCCCAGGAACT
GGGAATGGACGCGGTGGAGAACCAAGTGGGCGAACAGCCTTGGGAGGAGG
GCATCGAAGGCTTTCGTCGTGACTTTTACAGTAGGATTTGGATGACCTAC
CGTCGAGAGTTCCCAATAATGAATGGCTCCAACTACACCTCGGACTGCGG
TTGGGGCTGTATGCTAAGGAGTGGTCAGATGCTCTTCGCTCAAGGACTCA
TCTGTCACTTCCTAGGGCGAAGCTGGCGCTATGATTCAGAGTCCCAGTTG
CACTCGACTTACGAGGACAATATGCATAAGAAGATCGTCAAGTGGTTCGG
GGACAGTTCCTCAAAAAGCAGTCCCTTCTCCATCCACGCCCTGGTGCGGC
TGGGGGAGCATTTGGGTAAAAAACCTGGCGATTGGTACGGTCCCGCCTCT
GTTTCCTATTTGCTTAAACACGCCTTAGAGCACGCGGCTCAGGAAAATGC
AGACTTTGACAATATTAGTGTCTATGTAGCCAAAGATTGCACGATTTACT
TGCAAGATATTGAGGATCAATGCAGCATTCCGGAACCGGCGCCAAAACCC
CATGTGCCTTGGCAACAAGCGAAGCGGCCGCAGGCGGAAACTACCAAAAC
GGAGCAACAACAGCACTGGAAGTCCCTCATCGTTCTGATACCTTTGCGCC
TGGGCAGTGATAAACTGAATCCTGTGTATGCCCATTGTCTGAAGCTGCTG
CTGAGTACAGAACACTGCCTGGGCATCCTTGGTGGAAAGCCAAAGCATTC
GCTGTACTTTGTCGGCTTCCAGGAGGACAGGCTCATCCACTTGGATCCGC
ACTATTGCCAGGAGATGGTGGATGTGAACCAAGAGAACTTCTCCCTGCAC
TCGTTTCACTGCAAGTCGCCGCGGAAGCTTAAGGCCAGCAAAATGGATCC
TAGTTGTTGTATCGGCTTTTACTGTGCCACCAAAAGTGATTTCGACAATT
TTATGGAGAGCGTACAGTTGTATTTGCATCCTATGCGTTGCGCCTCAGGG
GCAACTGTGGATAAGGCGGCCGGGAGCCATCATACGACGCCTCAGTCATC
CCATCAAACCGAGCAAACAGAGATGAACTATCCATTGTTCTCATTTTCCC
GCGGTCGTTGCATGGATCACGAGCGGGACGAAATGAGCGATTCGCTGTAC
AAGCCGCTCATAAAACAGGTGGCTTCTCTGGCCCAGGAATTGGGCGCTCA
ACTGGCGCCGCCACAGCACGGCGATGAGCACGACCAAGATGATAGTGAAA
GCGAAGAGTTTGTGCTGCTGGCAAGCTTTCTAGACCAT

BO27577.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Atg4b-RA 2007 CG6194-PA 1..2004 17..2020 10020 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Atg4b-RA 2665 CG6194-RA 109..2112 17..2020 10020 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15355673..15356628 972..17 4780 100 Minus
3R 32079331 3R 15354633..15355108 1720..1245 2380 100 Minus
3R 32079331 3R 15354273..15354573 2020..1720 1505 100 Minus
3R 32079331 3R 15355420..15355615 1167..972 980 100 Minus
3R 32079331 3R 15355276..15355352 1244..1168 385 100 Minus
Blast to na_te.dros performed on 2014-11-28 05:08:33 has no hits.

BO27577.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:40 Download gff for BO27577.complete
Subject Subject Range Query Range Percent Splice Strand
CG6194-RA 104..2107 17..2022 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:25 Download gff for BO27577.complete
Subject Subject Range Query Range Percent Splice Strand
CG6194-RA 109..2112 17..2022 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:04:54 Download gff for BO27577.complete
Subject Subject Range Query Range Percent Splice Strand
Atg4b-RA 109..2112 17..2022 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:04:54 Download gff for BO27577.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15355674..15356628 17..971 100   Minus
3R 15355420..15355615 972..1167 100 <- Minus
3R 15355276..15355352 1168..1244 100 <- Minus
3R 15354633..15355108 1245..1720 100 <- Minus
3R 15354271..15354572 1721..2022 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:25 Download gff for BO27577.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11181396..11182350 17..971 100   Minus
arm_3R 11181142..11181337 972..1167 100 <- Minus
arm_3R 11180998..11181074 1168..1244 100 <- Minus
arm_3R 11180355..11180830 1245..1720 100 <- Minus
arm_3R 11179993..11180294 1721..2022 99 <- Minus

BO27577.pep Sequence

Translation from 16 to 2038

> BO27577.pep
MNYDGLLSKLTDEKLMLFEAAGEGTIVEGSRICGQDADPLSLPLVEDGAI
EEEQAAPIQTIHRTVFAVPRVPSPSPVSTSGANLNLKTENAATATPQRKI
STSSRFMNAFSQLYGGGNSGPSCGHVEQHNEEPGDLSANRTPTKGMESKL
VAMWHNVKYGWSGKMRQTSFSKEQPVWLLGRCYHRRFTPPVSMESSITEL
PSGADTTPDNATSAFDSIQATSTSTSLYPALNPQQIDEIVVPQELGMDAV
ENQVGEQPWEEGIEGFRRDFYSRIWMTYRREFPIMNGSNYTSDCGWGCML
RSGQMLFAQGLICHFLGRSWRYDSESQLHSTYEDNMHKKIVKWFGDSSSK
SSPFSIHALVRLGEHLGKKPGDWYGPASVSYLLKHALEHAAQENADFDNI
SVYVAKDCTIYLQDIEDQCSIPEPAPKPHVPWQQAKRPQAETTKTEQQQH
WKSLIVLIPLRLGSDKLNPVYAHCLKLLLSTEHCLGILGGKPKHSLYFVG
FQEDRLIHLDPHYCQEMVDVNQENFSLHSFHCKSPRKLKASKMDPSCCIG
FYCATKSDFDNFMESVQLYLHPMRCASGATVDKAAGSHHTTPQSSHQTEQ
TEMNYPLFSFSRGRCMDHERDEMSDSLYKPLIKQVASLAQELGAQLAPPQ
HGDEHDQDDSESEEFVLLASFLDH

BO27577.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
Atg4b-PA 668 CG6194-PA 1..668 1..668 3590 100 Plus
Atg4a-PB 410 CG4428-PB 63..333 263..567 452 32.9 Plus
Atg4a-PA 411 CG4428-PA 63..333 263..567 452 32.9 Plus