Clone BO27579 Report

Search the DGRC for BO27579

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:79
Vector:pDNR-Dual
Associated Gene/Transcriptvlc-RB
Protein status:BO27579.pep: Imported from assembly
Sequenced Size:1783

Clone Sequence Records

BO27579.complete Sequence

1783 bp assembled on 2010-09-13

GenBank Submission: KX796186

> BO27579.complete
GAAGTTATCAGTCGACATGGATCGCAGTCTGGACTCTATTGGCAGCTGTT
CACTGGATGTAGACGCCGACTCCTCCGATATATCAGATACCAGTGGGAGC
CTGAACTTTCCAACGCCGGTCTCAGTAAGGGACATAACACGCGAATTTAC
TGCCAACCTTCGGGAGCGCTGTGTGCCTAACTTGCCTCCCCAGCCTCAGC
ACAAAACCCCTGCCTACGTTGAATCCAGGTCGTCAGAGCTGGAGCACATG
GTGCTGTCACCTGCAATTGTGGAGTGCGACCAAGAGCCGAGCTCCAATGA
TTTTGACGAGACTTCTGCAGAAAATTCACAAGAAGCTCCCGAAAAGAAGC
CCAGCTATTTAAACCTGGCTTGCTGCGTCAACGGTTATTCCAACCTTACC
ACCTACGACTCCAAGATTCGGCAGGACATAAACAAGTCACCGACACCAAC
TCTGCACAGCATGCCTTCTCCGGCCACCAAGTGCAAACCCATCGAGCCTA
ACAACAACAGCAACGACAGTAGCGGGAATTTTAGTTCGGGTTCTGGTCAC
AGCAATGGAAATGGCAGTTTTATCAAGCAACGGGTGGAGCGACTTTACGG
GCCGGGTGCATTAGCCCAGGGTTTCTACAGCCCCAAAAAGCACGGCCAGT
CACCATCGAATGCTGCAGGGCGATCGGAAAGGGGGCAGGTGGAGATCGAC
TCTCTACAAGGCTCCGAACTGGCTCGGAAATTCAAGCAGCTCTCCCCCAG
TAAAGACTATGGGGAGTTTCGAAAAAAAATGCAGAAGAAGTGTTCTCAGA
GTACAACGGCGAGGATAGACGAGCCGTTGCATTCTCCAGGGCTTAACGGA
GATCTTGACCTGCCCGTGTTTAGGCACCTTAGTCAAGAGTTCCGCGCCCA
GTTGCCTACTGTGTCACCAAAAAGGGGTGCTCCTCGATCTTGCATGGCTC
CTGATGTACTGCTTGTAGATAACGAGTCAAGTCCAGACCATGGTCCCACA
GATGAAGTAGACCACGAATCCACAAAAATGGACAAACTAGCCTCAGAGGA
ATACATCAGCACTTCCAATATTTCTGTTGAAGCTGTTGTTAAGGATGGAA
ATTTCTTTCTGAAAATACTAAAAGAGGAACAAAGCCGTCTCTTGGTGCTA
GCCGCTCTTGCTGAAAAATATGCAGACGCCTTGTCTACAAATCCAGATAT
CTCCGAAGATACCTTTGGGCTACTGCGATCAGCGTCGGGTAAGGCCCGTC
TCTTGGTATCGCAGAAAATGAAACAATTCGAGGGTCTTTGCCACAATAAT
CTGAATCGCTCACCAGAGGATAAGTTTCCAACAACTCTGGATGATTTACA
AGGATTCTGGGATATGGTTTATTTGCAGGTGGAGCACGTGGATTCTATTT
TTGCTGATATAGAGAAACTCAAAAGTAACGACTGGAAGGTAAAAGCACAG
TCCGTCGCTGACCAACCCGATTTGCACACCATACCAACTAAGACAATAAA
GCCGTCAAAAGTCGGTGTTTCGCAAGTGAAAACAGTCGGAAAGGCATCCA
GCGTTCGTGTGAATGGCTCGGCACCTCCCCCACCTAACTCGGCAGCAGCT
TTAAAGAGGGAGGCCCAGAGAAAACTGCTTCTAGAGATGAAACGTCAGCG
TCGCGAGGCTATGACCGCAGCGGCCAAATTGAATCCCATAAATGTTGATG
CCGACCCGGACGTGCCGGGAATAATTGGCGATAGTTGTGCTAATCCTAGC
GTTAGCAACGGAAGTGCAAGCTTTCTAGACCAT

BO27579.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
vlc-RB 1752 CG8390-PB 1..1749 17..1765 8745 100 Plus
vlc-RI 1818 CG8390-PI 491..1815 441..1765 6625 100 Plus
vlc-RH 1818 CG8390-PH 491..1815 441..1765 6625 100 Plus
vlc-RI 1818 CG8390-PI 1..424 17..440 2120 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
vlc-RB 2388 CG8390-RB 116..1865 16..1765 8750 100 Plus
vlc-RH 2369 CG8390-RH 522..1846 441..1765 6625 100 Plus
vlc-RI 2425 CG8390-RI 578..1902 441..1765 6625 100 Plus
vlc-RI 2425 CG8390-RI 87..511 16..440 2125 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5703471..5704216 441..1186 3730 100 Plus
2R 25286936 2R 5704434..5704916 1283..1765 2415 100 Plus
2R 25286936 2R 5703048..5703404 84..440 1785 100 Plus
2R 25286936 2R 5704286..5704384 1187..1285 495 100 Plus
2R 25286936 2R 5702877..5702947 16..86 355 100 Plus
Blast to na_te.dros performed 2014-11-28 05:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 5601..5673 451..523 122 63 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1854..1960 1159..1053 120 60.6 Minus

BO27579.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:39 Download gff for BO27579.complete
Subject Subject Range Query Range Percent Splice Strand
vlc-RB 120..1868 17..1767 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:20 Download gff for BO27579.complete
Subject Subject Range Query Range Percent Splice Strand
vlc-RB 117..1865 17..1767 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:04:02 Download gff for BO27579.complete
Subject Subject Range Query Range Percent Splice Strand
vlc-RB 117..1865 17..1767 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:04:02 Download gff for BO27579.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5704435..5704916 1284..1767 99   Plus
2R 5704286..5704382 1187..1283 100 -> Plus
2R 5703471..5704216 441..1186 100 -> Plus
2R 5703051..5703404 87..440 100 -> Plus
2R 5702878..5702947 17..86 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:20 Download gff for BO27579.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1591940..1592421 1284..1767 99   Plus
arm_2R 1591791..1591887 1187..1283 100 -> Plus
arm_2R 1590976..1591721 441..1186 100 -> Plus
arm_2R 1590556..1590909 87..440 100 -> Plus
arm_2R 1590383..1590452 17..86 100 -> Plus

BO27579.pep Sequence

Translation from 16 to 1783

> BO27579.pep
MDRSLDSIGSCSLDVDADSSDISDTSGSLNFPTPVSVRDITREFTANLRE
RCVPNLPPQPQHKTPAYVESRSSELEHMVLSPAIVECDQEPSSNDFDETS
AENSQEAPEKKPSYLNLACCVNGYSNLTTYDSKIRQDINKSPTPTLHSMP
SPATKCKPIEPNNNSNDSSGNFSSGSGHSNGNGSFIKQRVERLYGPGALA
QGFYSPKKHGQSPSNAAGRSERGQVEIDSLQGSELARKFKQLSPSKDYGE
FRKKMQKKCSQSTTARIDEPLHSPGLNGDLDLPVFRHLSQEFRAQLPTVS
PKRGAPRSCMAPDVLLVDNESSPDHGPTDEVDHESTKMDKLASEEYISTS
NISVEAVVKDGNFFLKILKEEQSRLLVLAALAEKYADALSTNPDISEDTF
GLLRSASGKARLLVSQKMKQFEGLCHNNLNRSPEDKFPTTLDDLQGFWDM
VYLQVEHVDSIFADIEKLKSNDWKVKAQSVADQPDLHTIPTKTIKPSKVG
VSQVKTVGKASSVRVNGSAPPPPNSAAALKREAQRKLLLEMKRQRREAMT
AAAKLNPINVDADPDVPGIIGDSCANPSVSNGSASFLDH

BO27579.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:43
Subject Length Description Subject Range Query Range Score Percent Strand
vlc-PB 583 CG8390-PB 1..583 1..583 3016 100 Plus
vlc-PI 605 CG8390-PI 1..605 1..583 2975 96.2 Plus
vlc-PH 605 CG8390-PH 1..605 1..583 2975 96.2 Plus
vlc-PG 605 CG8390-PG 1..605 1..583 2975 96.2 Plus
vlc-PF 605 CG8390-PF 1..605 1..583 2975 96.2 Plus