Clone BO27587 Report

Search the DGRC for BO27587

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:275
Well:87
Vector:pDNR-Dual
Associated Gene/Transcriptfax-RD
Protein status:BO27587.pep: Imported from assembly
Sequenced Size:871

Clone Sequence Records

BO27587.complete Sequence

871 bp assembled on 2010-08-18

GenBank Submission: KX794247

> BO27587.complete
GAAGTTATCAGTCGACATGGCCCTCAATGTCGATCATAAGATGCGTTTCC
GCTCCAAGAAGGGTCAGCTGCCGTTCATCGAGCTGAATGGGGAGGAAATC
GCCGATTCGGCCATCATCATCAAGGAACTGTCGTCCAAATACGAGAAGTA
CCTGGACTCGGGACTCACCGCCGAGCAAAGGAATGTCTCGTACGCCACGA
TTGCCATGCTGGAGAACCATCTCATCTGGATCATCTTCTACTGGCGCGCC
AAGTATCCGGACAATGTGCTCAAGGGCTACAAGGTCAACTTGCAGCACGC
CCTCGGCCTGCGGCTGCCCAACTCGATTCTGAACTTCTTCTTTAAGATCA
CCTTTGGTCGCAAGGGCACGAAGAAGCTGAAGGCGCACGGCATCGGTGTC
CACAGCGCCGAGGAGATCGAGGAGTTCGGCAAGGACGACCTGAAGGTGCT
CAGCGAGATGCTCGACTGCAAGCCTTTCTTCTTCGGCGACGAGCCCACCA
CCCTGGATGTGGTGGCCTTCGCTGTCCTCTCGCAGCTCCACTATCTGTCC
AAGGACATTGCGTATCCGCTGCGCGACTACATGACCGAGAAGTGCCCCAA
CTTGATTGGCCACGTATCTCGCATGAAGGACAAGTGCTTCCCCGACTGGG
ACGAGATCTGCACGAAGCTGGACCTCAATGCGCACATTCCCAAGCCAGAG
CCCGAGACCAAGGAGGGCAAGGAGGGTGGCGAGCAGGAGAAATCAAACGA
ACAGGAGGGCACTGAGGGCGACAAGATCGAGAAGGAGTTGGAGAAGGACA
AGTCAAACGAGAAGGAGTCGACCGAGGAGAACAAAGAGAAGGAGGAAACA
AAGGCAAGCTTTCTAGACCAT

BO27587.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
fax-RD 840 CG4609-PD 1..837 17..853 4185 100 Plus
fax-RC 1248 CG4609-PC 418..1245 26..853 4140 100 Plus
fax-RE 816 CG4609-PE 1..813 41..853 4065 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
fax-RD 3274 CG4609-RD 114..950 17..853 4185 100 Plus
fax-RE 3209 CG4609-RE 58..885 26..853 4140 100 Plus
fax-RC 3153 CG4609-RC 784..1611 26..853 4140 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16407020..16407359 365..26 1700 100 Minus
3L 28110227 3L 16405501..16405838 700..363 1690 100 Minus
3L 28110227 3L 16405326..16405428 802..700 515 100 Minus
3L 28110227 3L 16405120..16405172 853..801 265 100 Minus
Blast to na_te.dros performed 2014-11-28 02:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy3 6973 gypsy3 GYPSY3 6973bp 4503..4564 188..250 114 66.7 Plus

BO27587.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:55:16 Download gff for BO27587.complete
Subject Subject Range Query Range Percent Splice Strand
fax-RD 110..946 17..855 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:18:51 Download gff for BO27587.complete
Subject Subject Range Query Range Percent Splice Strand
fax-RD 110..946 17..855 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:15:43 Download gff for BO27587.complete
Subject Subject Range Query Range Percent Splice Strand
fax-RD 114..950 17..855 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:15:43 Download gff for BO27587.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16407021..16407359 26..364 100   Minus
3L 16405502..16405836 365..699 100 <- Minus
3L 16405326..16405428 700..802 100 <- Minus
3L 16405118..16405170 803..855 96 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:18:51 Download gff for BO27587.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16400121..16400459 26..364 100   Minus
arm_3L 16398602..16398936 365..699 100 <- Minus
arm_3L 16398426..16398528 700..802 100 <- Minus
arm_3L 16398218..16398270 803..855 96 <- Minus

BO27587.pep Sequence

Translation from 16 to 871

> BO27587.pep
MALNVDHKMRFRSKKGQLPFIELNGEEIADSAIIIKELSSKYEKYLDSGL
TAEQRNVSYATIAMLENHLIWIIFYWRAKYPDNVLKGYKVNLQHALGLRL
PNSILNFFFKITFGRKGTKKLKAHGIGVHSAEEIEEFGKDDLKVLSEMLD
CKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHV
SRMKDKCFPDWDEICTKLDLNAHIPKPEPETKEGKEGGEQEKSNEQEGTE
GDKIEKELEKDKSNEKESTEENKEKEETKASFLDH

BO27587.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
fax-PD 279 CG4609-PD 1..279 1..279 1469 100 Plus
fax-PC 415 CG4609-PC 140..415 4..279 1456 100 Plus
fax-PB 282 CG4609-PB 1..282 1..279 1455 98.9 Plus
fax-PA 418 CG4609-PA 140..418 4..279 1442 98.9 Plus
fax-PE 271 CG4609-PE 1..271 9..279 1427 100 Plus