Clone BO27601 Report

Search the DGRC for BO27601

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:276
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptRpS11-RB
Protein status:BO27601.pep: Imported from assembly
Sequenced Size:496

Clone Sequence Records

BO27601.complete Sequence

496 bp assembled on 2010-08-18

GenBank Submission: KX796972

> BO27601.complete
GAAGTTATCAGTCGACATGGCTGATCAGCAAACCGAACGCTCGTTCCGCA
AGCAACACGCGGTGGTCGTTGTGCGTCGCAAGAGCCCCAACTTGAAGAAA
AGGCCCCGTTTCTATCGCCAAATTGGCCTGGGCTTCCGCGCTCCGGCGGA
GGCCATCGATGGTACCTACATCGACAAGAAGTGCCCCTGGACCGGTGATG
TGAGGATCCGTGGTCGCATTCTGACCGGCGTGGTCCGCAAGGCCAAGATG
CAGCGCACCATTGTCATTCGGCGCGACTACCTGCACTTTGTGCGCAAATA
CAGCCGTTTCGAGAAGCGTCACCGCAACATGAGCGTCCACTGCTCCCCTG
TGTTCAGAGATGTTGAGCATGGCGATATTGTCACCATTGGTGAGTGCCGT
CCTCTGTCCAAGACTGTGCGCTTCAACGTCCTGAAAGTCAGCAAGGGTCA
GGGAGCCAAGAAGAGCTTCAAGAAGTACGCAAGCTTTCTAGACCAT

BO27601.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-RB 465 CG8857-PB 1..462 17..478 2310 100 Plus
RpS11-RC 468 CG8857-PC 136..465 149..478 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-RB 569 CG8857-RB 28..491 15..478 2320 100 Plus
RpS11-RC 738 CG8857-RC 165..494 149..478 1650 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12199834..12200041 357..150 1040 100 Minus
2R 25286936 2R 12200427..12200553 152..26 635 100 Minus
2R 25286936 2R 12199469..12199592 478..355 620 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:56:59 has no hits.

BO27601.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:53:10 Download gff for BO27601.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RB 43..504 17..480 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:25 Download gff for BO27601.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RB 30..491 17..480 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:28:02 Download gff for BO27601.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RB 30..491 17..480 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:28:02 Download gff for BO27601.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12200428..12200555 22..151 98   Minus
2R 12199834..12200039 152..357 100 <- Minus
2R 12199467..12199589 358..480 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:25 Download gff for BO27601.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8087933..8088060 22..151 98   Minus
arm_2R 8087339..8087544 152..357 100 <- Minus
arm_2R 8086972..8087094 358..480 98 <- Minus

BO27601.pep Sequence

Translation from 16 to 496

> BO27601.pep
MADQQTERSFRKQHAVVVVRRKSPNLKKRPRFYRQIGLGFRAPAEAIDGT
YIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEK
RHRNMSVHCSPVFRDVEHGDIVTIGECRPLSKTVRFNVLKVSKGQGAKKS
FKKYASFLDH

BO27601.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-PB 154 CG8857-PB 1..154 1..154 807 100 Plus
RpS11-PC 155 CG8857-PC 1..155 1..154 660 83.3 Plus