Clone BO27602 Report

Search the DGRC for BO27602

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:276
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG5196-RA
Protein status:BO27602.pep: Imported from assembly
Sequenced Size:1315

Clone Sequence Records

BO27602.complete Sequence

1315 bp assembled on 2010-10-15

GenBank Submission: KX795385

> BO27602.complete
GAAGTTATCAGTCGACATGAGTCCTGAAATATCCGGCTTCCGGCGGTTCC
TGCATTGGGGCCCCATTACCGCCCTTAGCATCATCAAGTGCATAACGCTG
ACAACGCTCTATATGAACTCGATGTGGTGGCCGCCAAATAAATCATTCGC
CGGATTCGCCCACCAGGCCCTCTTCCTGCTCCTTTCCACGCTGGCCACAT
TCAATTACGTCATGGCCACTTTGACTGGTCCCGGACTGATGCCAAAACAG
TGGCATCCCAAGGATCCCAAGGACGCCCAGTTCCTGCAGTACTGCAAAAA
GTGCGAGGGCTACAAGGCACCACGCTCCCATCATTGTCGCAAGTGTGATC
GCTGCGTCAAGAAGATGGACCATCACTGCCCATGGATCAATCACTGCGTT
GGCTGGGCCAACCACGCGTACTTCACATACTTCCTGCTCTTCTCCATCCT
GGGCAGCCTGCAGGGCACCGTGGTGCTATGCTGCTCCTTCTGGCGGGGAA
TCTACCGCTACTACTATCTCACCCACGGATTGGCGCACTTGGCTAGCGTG
CAGTTCACTCTGCTCAGCATCATCATGTGCATTCTGGGCATGGGCCTGGC
CATCGGTGTCGTCATTGGCCTGAGCATGCTGCTGTTCATTCAGCTGAAGA
CGATTGTAAACAACCAGACGGGCATAGAGATCTGGATAGTGGAGAAGGCC
ATTTACCGCCGATATAGGAATGCCGACTGCGACGACGAGTTCCTATATCC
CTATGATTTGGGCTGGCGGGCAAATTTGCGACTGGTATTCAATGACGAGT
GCCAAAAGCGAGGCGATGGCATCGAGTGGCCAGTGGTGGAGGGTTGTGAT
CAGTATACATTGACGCGCGAGCAACTGGCGCAGAAGGAGGAGAAACGAGC
TCGAACCCGCACCTTCAAATGCACAAGGCCAGTGACTGGCCGTTGGCTGC
CGATCTTTTCGCAGGGTTGGCGTGTTTGTGTGGCCGCTCCCTGCTCCGAT
GAGCCACGCATCAGCCTGCGACCCAACGACATGATTAAGGTCACTCGCTT
CCGCAACCACTGGCTGTTCGGCGAGCGAGTGCTTTCCGAGCAAGAGCTAG
CTGGCGTCAAGAAGCGCCAACGCAAGGGTCCCATTCGTGGCTGGTTCCCA
CGACGCAGCGCCGTTGAGGTCATTGAGGCGGTCCATGAAGGCAGCGGCGA
TGGCAACAGCGAGACACCAGCACCTGCGGCCCAGAATGGCAACGCCCACA
GCCACTTGAAGCAGCAGCAGCGAAACGGACATGCCAAAAAGTACATGGCA
AGCTTTCTAGACCAT

BO27602.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:00:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG5196-RA 1284 CG5196-PA 1..1281 17..1297 6390 99.9 Plus
CG5196-RB 1188 CG5196-PB 1..1185 113..1297 5910 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG5196-RA 1679 CG5196-RA 97..1377 17..1297 6390 99.9 Plus
CG5196-RB 2023 CG5196-RB 502..1721 78..1297 6085 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12410460..12410980 345..865 2590 99.8 Plus
3R 32079331 3R 12411034..12411466 865..1297 2165 100 Plus
3R 32079331 3R 12409255..12409440 78..263 930 100 Plus
3R 32079331 3R 12410273..12410358 261..346 430 100 Plus
3R 32079331 3R 12408412..12408473 17..78 310 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:00:06 has no hits.

BO27602.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:22:57 Download gff for BO27602.complete
Subject Subject Range Query Range Percent Splice Strand
CG5196-RA 91..1371 17..1299 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:06 Download gff for BO27602.complete
Subject Subject Range Query Range Percent Splice Strand
CG5196-RA 97..1377 17..1299 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:24 Download gff for BO27602.complete
Subject Subject Range Query Range Percent Splice Strand
CG5196-RA 97..1377 17..1299 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:24 Download gff for BO27602.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12411035..12411466 866..1299 99   Plus
3R 12410460..12410980 345..865 99 -> Plus
3R 12410275..12410356 263..344 100 -> Plus
3R 12409255..12409439 78..262 100 -> Plus
3R 12408412..12408472 17..77 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:06 Download gff for BO27602.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8236757..8237188 866..1299 99   Plus
arm_3R 8236182..8236702 345..865 99 -> Plus
arm_3R 8235997..8236078 263..344 100 -> Plus
arm_3R 8234977..8235161 78..262 100 -> Plus
arm_3R 8234134..8234194 17..77 100 -> Plus

BO27602.pep Sequence

Translation from 16 to 1315

> BO27602.pep
MSPEISGFRRFLHWGPITALSIIKCITLTTLYMNSMWWPPNKSFAGFAHQ
ALFLLLSTLATFNYVMATLTGPGLMPKQWHPKDPKDAQFLQYCKKCEGYK
APRSHHCRKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQG
TVVLCCSFWRGIYRYYYLTHGLAHLASVQFTLLSIIMCILGMGLAIGVVI
GLSMLLFIQLKTIVNNQTGIEIWIVEKAIYRRYRNADCDDEFLYPYDLGW
RANLRLVFNDECQKRGDGIEWPVVEGCDQYTLTREQLAQKEEKRARTRTF
KCTRPVTGRWLPIFSQGWRVCVAAPCSDEPRISLRPNDMIKVTRFRNHWL
FGERVLSEQELAGVKKRQRKGPIRGWFPRRSAVEVIEAVHEGSGDGNSET
PAPAAQNGNAHSHLKQQQRNGHAKKYMASFLDH

BO27602.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG5196-PA 427 CG5196-PA 1..427 1..427 2354 100 Plus
CG5196-PB 395 CG5196-PB 1..395 33..427 2184 100 Plus
CG4483-PA 435 CG4483-PA 10..383 9..387 1066 49.1 Plus
CG8314-PA 293 CG8314-PA 39..273 23..250 243 26.9 Plus
Dnz1-PA 276 CG6627-PA 27..235 22..234 237 29.4 Plus