Clone BO27617 Report

Search the DGRC for BO27617

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:276
Well:17
Vector:pDNR-Dual
Associated Gene/TranscriptCG8563-RA
Protein status:BO27617.pep: Imported from assembly
Sequenced Size:1354

Clone Sequence Records

BO27617.complete Sequence

1354 bp assembled on 2010-08-18

GenBank Submission: KX797748

> BO27617.complete
GAAGTTATCAGTCGACATGTGGCAGGGAATCGTGTGCAGCTTGGCTTTAT
GCCTCGTCGGATTGGCGGGTCTCGGCATCGCCAACAATCTCGCCGGCTAC
GAAGGTTATACAAAATACACGGTGCAACATGGAGACGAGAATGCCTTCAA
GTACATGGTCGACCTGCAGACGAATGACGCGGAGCTGGACTTTTGGTTGC
TGACCAGAAACTCCTCCGTGCTGACAGTGAGTCCCCGGCGGAAGACACAG
TTCGAGGCGAGTCTTTCCAGTTTGGGAGTTAGCTACGAGATGCAGCCGCT
CATGGAGCTGATGGCGGCCCTTCAAGCGAACAGTTCCTTTGCGGATGACA
ACTACGATGGGGAGTACGAGGAGTGCCAGCAGGATGAGTGCGAGCAGGCG
GAGCGACCACGTCGAAGGACTCGTCGTCAGGCTCGCGGCTTCTTCTCGCA
CTATCCGCGGTATCATGAGGTGCTCAGCTTCATGAGTGGCTTGGCCGCCA
GATATCCTCAGTTCTGCCGCTATGAATCCTTGGGTCGTTCCAACGAGGGT
CGCCACATAGCTGCTCTCTCTATTTCACTGAACAGTAGGGTACGTCCTCG
TCGAGTGGCCTATATCCAGGCAGCCACCCACGGTAGGGAGTGGATTACTA
CGCAGACCGTTCTCTACTTGGCCTACGAACTGCTGAGCAATCTGCGCGCC
TTCACGAGGGTCCTGCAGGATGTGGAGATCTTTCTGGTGCCGCTGGTCAA
TCCCGATGGCTATGAATACACGCACACAACGGATCGTTTCTGGCGCAAGA
ACCGTCATCGTTATGCGGGTCATTCCTGCTCCGGCGTGGACATCAATCGT
AACTTTGGCAATCACTGGAACTATCAGGGAGCCAGCCAGAACCTCTGCTC
GGAGGTGTACTCGGGCACTGCGCCCAATTCGGAGCCGGAGACCTCGGCGG
TGGTGCGGTATCTGGAATTCAATCGAAACCGTGTGAAACTCAGCCTGGAT
GTTCACTCATTTGGCAAATTCATTTTTTATCCCTACGGCTATGCGAAAAA
CACCGTGCCACCAACCGTGGGAACGCTGCGCTCGGTGGCTCTGAGGGCCG
CCAACCAGATCGGCAGGTACCGTGGAACGCGCTACACCACCGGCACCTCC
GCCTCCATTTTGTACGAGGCCTCCGGCAGCTTGGACGACTTCGCCTATGG
CAATCTGGGAATCCCGCTGTCCTACACGCTCGAGCTGCCCGGTGACGAGT
TCCATGTGCCCGCCCACGACATCATCCACGTCTGCAAGGAGACATTCGCC
GGCTTCATCGAGTTCATCCGGCACGTCAGCCTTTACGCAAGCTTTCTAGA
CCAT

BO27617.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8563-RB 1323 CG8563-PB 1..1320 17..1336 6585 99.9 Plus
CG8563-RA 1323 CG8563-PA 1..1320 17..1336 6585 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8563-RB 2121 CG8563-RB 690..2009 17..1336 6585 99.9 Plus
CG8563-RA 1786 CG8563-RA 355..1674 17..1336 6585 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7393592..7394269 105..782 3375 99.9 Plus
3L 28110227 3L 7395613..7395901 1048..1336 1445 100 Plus
3L 28110227 3L 7394936..7395090 893..1047 775 100 Plus
3L 28110227 3L 7394737..7394848 781..892 560 100 Plus
3L 28110227 3L 7391431..7391519 17..105 445 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:42:56 has no hits.

BO27617.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:16 Download gff for BO27617.complete
Subject Subject Range Query Range Percent Splice Strand
CG8563-RA 353..1672 17..1338 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:19 Download gff for BO27617.complete
Subject Subject Range Query Range Percent Splice Strand
CG8563-RA 355..1674 17..1338 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:02 Download gff for BO27617.complete
Subject Subject Range Query Range Percent Splice Strand
CG8563-RA 355..1674 17..1338 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:02 Download gff for BO27617.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7395613..7395901 1048..1338 99   Plus
3L 7394936..7395090 893..1047 100 -> Plus
3L 7394738..7394848 782..892 100 -> Plus
3L 7393593..7394268 106..781 99 -> Plus
3L 7391431..7391519 17..105 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:19 Download gff for BO27617.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7388713..7389001 1048..1338 99   Plus
arm_3L 7388036..7388190 893..1047 100 -> Plus
arm_3L 7387838..7387948 782..892 100 -> Plus
arm_3L 7386693..7387368 106..781 99 -> Plus
arm_3L 7384531..7384619 17..105 100 -> Plus

BO27617.pep Sequence

Translation from 16 to 1354

> BO27617.pep
MWQGIVCSLALCLVGLAGLGIANNLAGYEGYTKYTVQHGDENAFKYMVDL
QTNDAELDFWLLTRNSSVLTVSPRRKTQFEASLSSLGVSYEMQPLMELMA
ALQANSSFADDNYDGEYEECQQDECEQAERPRRRTRRQARGFFSHYPRYH
EVLSFMSGLAARYPQFCRYESLGRSNEGRHIAALSISLNSRVRPRRVAYI
QAATHGREWITTQTVLYLAYELLSNLRAFTRVLQDVEIFLVPLVNPDGYE
YTHTTDRFWRKNRHRYAGHSCSGVDINRNFGNHWNYQGASQNLCSEVYSG
TAPNSEPETSAVVRYLEFNRNRVKLSLDVHSFGKFIFYPYGYAKNTVPPT
VGTLRSVALRAANQIGRYRGTRYTTGTSASILYEASGSLDDFAYGNLGIP
LSYTLELPGDEFHVPAHDIIHVCKETFAGFIEFIRHVSLYASFLDH

BO27617.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG8563-PB 440 CG8563-PB 1..440 1..440 2331 100 Plus
CG8563-PA 440 CG8563-PA 1..440 1..440 2331 100 Plus
CG8560-PB 418 CG8560-PB 2..406 9..429 545 32.6 Plus
CG8560-PA 418 CG8560-PA 2..406 9..429 545 32.6 Plus
CG18417-PA 427 CG18417-PA 108..420 135..437 500 37.3 Plus