Clone BO27625 Report

Search the DGRC for BO27625

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:276
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptOsi15-RA
Protein status:BO27625.pep: Imported from assembly
Sequenced Size:676

Clone Sequence Records

BO27625.complete Sequence

676 bp assembled on 2010-08-18

GenBank Submission: KX794865

> BO27625.complete
GAAGTTATCAGTCGACATGTGCGCGAAATTCGTATGTGTAGTGCTGCTGG
CCAGCCTTGTGTGCGGTTCCATGGCCCTTCCCTCCCAGGACAACACCGAG
CGGGACCTGGTCAACATGCTGAACCGCTTAGACAGCGAGGAGTCCGTCGC
GCTGTTCGGCGGTCTGAGGATCGACCGGTCGGAGTCGGGCCGTAGCTTCG
GTGCATCCAAGGCCGTCGAGTCCTTCGAGGACCGCGCCGAGCGCTACCTG
GAGACCCACGAGCTAAACCTCTCCTTCTCCGGCGATGAGCAGGACGAGAA
CTCCGAGAACGAGTACACCGGACGCGCCATGGATGAGTCCCGCAGCAAGC
GCATGAAGAAGATGCTGCTGCCCCTTCTTTTGGCCCTGAAGCTGAAGAAG
GCCGTCGTTGTCAAGATTATGTTCACCATCATCAAGTTCATCTCGCTGAA
GGCTCTGGCCATCTCCTTCCTGGCCCTCATCCTGGCTGGTGCCACCTTCT
TCAAGGATCTGTTGGCCAAGAAGAAGGAACACATCACCACTGCCTACATC
ACCGGCAGCCCGCTGAACGCCGACATCGTGCACTCCGACTGGAGCCGCAA
TGGTCAGGCAGGTGCCGCCGATCTGGCCTACAACCACTATGGTCTGGCCC
AGCCCTTCGCAAGCTTTCTAGACCAT

BO27625.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
Osi15-RA 645 CG1157-PA 1..642 17..658 3210 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
Osi15-RA 1232 CG1157-RA 110..751 17..658 3210 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6301913..6302231 17..335 1595 100 Plus
3R 32079331 3R 6303002..6303172 488..658 855 100 Plus
3R 32079331 3R 6302791..6302947 335..491 785 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:42:52 has no hits.

BO27625.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:15 Download gff for BO27625.complete
Subject Subject Range Query Range Percent Splice Strand
Osi15-RA 108..749 17..660 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:18 Download gff for BO27625.complete
Subject Subject Range Query Range Percent Splice Strand
Osi15-RA 110..751 17..660 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:00 Download gff for BO27625.complete
Subject Subject Range Query Range Percent Splice Strand
Osi15-RA 110..751 17..660 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:00 Download gff for BO27625.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6303003..6303172 489..660 98   Plus
3R 6302792..6302944 336..488 100 -> Plus
3R 6301913..6302231 17..335 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:18 Download gff for BO27625.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2128725..2128894 489..660 98   Plus
arm_3R 2128514..2128666 336..488 100 -> Plus
arm_3R 2127635..2127953 17..335 100 -> Plus

BO27625.pep Sequence

Translation from 16 to 676

> BO27625.pep
MCAKFVCVVLLASLVCGSMALPSQDNTERDLVNMLNRLDSEESVALFGGL
RIDRSESGRSFGASKAVESFEDRAERYLETHELNLSFSGDEQDENSENEY
TGRAMDESRSKRMKKMLLPLLLALKLKKAVVVKIMFTIIKFISLKALAIS
FLALILAGATFFKDLLAKKKEHITTAYITGSPLNADIVHSDWSRNGQAGA
ADLAYNHYGLAQPFASFLDH

BO27625.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
Osi15-PA 214 CG1157-PA 1..214 1..214 1069 100 Plus
Osi9-PA 233 CG15592-PA 3..197 4..172 155 30.3 Plus