Clone BO27626 Report

Search the DGRC for BO27626

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:276
Well:26
Vector:pDNR-Dual
Associated Gene/Transcriptantdh-RA
Protein status:BO27626.pep: Imported from assembly
Sequenced Size:784

Clone Sequence Records

BO27626.complete Sequence

784 bp assembled on 2010-08-18

GenBank Submission: KX795443

> BO27626.complete
GAAGTTATCAGTCGACATGGAACGCTGGCAGAATCGCGTGGCCGTCGTCA
CTGGCGCCAGTTCGGGCATCGGATCGGCCATAGCCAAGGATCTGGTCCTA
GCCGGAATGACGGTGGTGGGTCTGGCCCGACGTGTCGATCGCGTCAAGGA
GCTGCAGAGGGAGCTGCCGGCGGAGAAGCGCGGCAAACTTTTTGCCCTCT
ACTGCGACGTGGGCAACGAGAGTTCCGTAAACGAGGCCTTCGATTGGATC
ATCCAAAAGTTGGGCGCCATCGATGTGCTGGTCAACAATGCCGGCACCCT
GCAACCCGGCTATCTGGTGGACATGAATCCGGCCGTAATGCAGCAGGTAT
TGCAGACGAACATCATGGGCATCGTGCTGTGCACCCAGCGAGCGGTGCGT
TCCATGCGGGAGCGCAAGTTCGACGGCCATGTGGTGCTCATCAATAGCAT
CCTGGGGCACAAGACCATGACGGCCACGGAGGGCGTGGCGCCCGATGTGA
ACGTCTATCCGCCCAGCAAGCATGCAGTTACAGCGCTGGCCGAAGGATAT
CGCCAGGAGTTCTTCGGCCTGGGCACCCGCATCAAGATTACGAGCGTCAG
TCCGGGCGTGGTGGACACGGAGATCGTGCCGGACAGCATTAGGGAGGCCA
TCAAGGATCGAATGCTCCACTCCGAGGACATCGCACAGGGAGTGCTGTAC
GCCATCGCCACACCGCCACATGTCCAGGTGCACGAGCTGATCATCAAGCC
ACTTGGCGAGACCATGGCAAGCTTTCTAGACCAT

BO27626.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:42:48
Subject Length Description Subject Range Query Range Score Percent Strand
antdh-RA 753 CG1386-PA 1..750 17..766 3750 100 Plus
CG10962-RB 750 CG10962-PB 1..139 17..155 200 76.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
antdh-RA 950 CG1386-RA 29..779 16..766 3755 100 Plus
CG10962-RB 1074 CG10962-RB 29..167 17..155 200 76.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11168454..11169030 592..16 2885 100 Minus
X 23542271 X 11168201..11168375 766..592 875 100 Minus
X 23542271 X 8974089..8974227 155..17 200 76.3 Minus
Blast to na_te.dros performed on 2014-11-28 02:42:46 has no hits.

BO27626.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:14 Download gff for BO27626.complete
Subject Subject Range Query Range Percent Splice Strand
antdh-RA 30..779 17..768 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:16 Download gff for BO27626.complete
Subject Subject Range Query Range Percent Splice Strand
antdh-RA 30..779 17..768 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:58 Download gff for BO27626.complete
Subject Subject Range Query Range Percent Splice Strand
antdh-RA 30..779 17..768 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:58 Download gff for BO27626.complete
Subject Subject Range Query Range Percent Splice Strand
X 11168454..11169029 17..592 100   Minus
X 11168199..11168374 593..768 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:16 Download gff for BO27626.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11062487..11063062 17..592 100   Minus
arm_X 11062232..11062407 593..768 98 <- Minus

BO27626.pep Sequence

Translation from 16 to 784

> BO27626.pep
MERWQNRVAVVTGASSGIGSAIAKDLVLAGMTVVGLARRVDRVKELQREL
PAEKRGKLFALYCDVGNESSVNEAFDWIIQKLGAIDVLVNNAGTLQPGYL
VDMNPAVMQQVLQTNIMGIVLCTQRAVRSMRERKFDGHVVLINSILGHKT
MTATEGVAPDVNVYPPSKHAVTALAEGYRQEFFGLGTRIKITSVSPGVVD
TEIVPDSIREAIKDRMLHSEDIAQGVLYAIATPPHVQVHELIIKPLGETM
ASFLDH

BO27626.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
antdh-PA 250 CG1386-PA 1..250 1..250 1263 100 Plus
CG40485-PB 247 CG40485-PB 1..245 1..248 697 54.4 Plus
CG40486-PC 247 CG40486-PC 1..245 1..248 694 54.8 Plus
CG40486-PB 247 CG40486-PB 1..245 1..248 694 54.8 Plus
CG10962-PB 249 CG10962-PB 1..247 1..248 618 49 Plus