Clone BO27645 Report

Search the DGRC for BO27645

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:276
Well:45
Vector:pDNR-Dual
Associated Gene/Transcriptbl-RC
Protein status:BO27645.pep: Imported from assembly
Sequenced Size:1540

Clone Sequence Records

BO27645.complete Sequence

1540 bp assembled on 2010-08-18

GenBank Submission: KX798870

> BO27645.complete
GAAGTTATCAGTCGACATGACAAAGAGACTGAGAATGAAGCGTGAAATGA
ACGATGAAGGGGAGGGACCACAGGACCAGAAGCGCAATCGCCGCAACGAG
GAGACCGTTCGCATACTGATTCCGAGCAGTATTGCTGGGGCTGTCATTGG
CAAAGGAGGACAGCACATTCAGAAGATGAGGACTCAGTATAAAGCCACTG
TGTCTGTCGACGATTCCCAAGGCCCCGAACGAACCATCCAAATATCGGCG
GATATAGAGTCCACATTGGAGATTATCACCGAAATGCTGAAATACTTTGA
GGAGCGCGACGAGGACTTTGATGTGCGTCTACTTATACACCAGAGCTTGG
CCGGCTGCGTCATTGGCAAAGGTGGACAAAAGATCAAGGAGATCCGCGAT
CGCATCGGCTGCCGCTTTTTGAAGGTCTTCTCGAATGTGGCACCACAGAG
CACAGATCGAGTGGTGCAGACCGTTGGCAAGCAGAGCCAGGTCATCGAAG
CGGTTCGTGAGGTGATCACACTTACACGGGACACTCCCATCAAGGGGGCG
ATACATAACTATGATCCTATGAACTTTGACCGCGTATATGCCGATGAGTA
CGGTGGCTATGGCACTGGAAGTGGCAGTACCCGTCCAAGTCAGCGGGGAA
ACAATCGTAACGGAGGAGGCGCTGGAGGTGTTGCCGGCGGCGCAGCCGGT
GGCAATGGTGGAGGATTCAATGCTGGCGGTGCACGCGGCAATGCTGGCGG
ACGTGGCGGAGCTGATCGCTTTGGCGGCGCCGCTGGTGGAGCTGTGGCCG
GTGCTGGAATGGGGCAGCGCGACAATCCGTTCATTAATCCGTGGGCCAAT
GGCGGTGGCGGTGATGTAGATGGTTTTGGCAACAACGCTGGTGGTGCTGG
TGGATTTGCCGGTAACAGCTTTGGCGGTGGCGCCGGTGGACCATTCGGAG
GTGGTAGCTTTGGCAACAACGGTTTCGGAGGTGGACCCAGCGACTTTGGC
GGAAATTCCGGAAACTTTGGACAGGCCCAGGGCACTAACAGTCTGCCAAG
CCTTGGTAGCTTCAGCCAGAACCAGGGTGGCACTAGCAGCCTGCCCAGCT
TGGGCAGCTTTGGTCAGAATCCAGGCGGACCCGGTGGATTGGGTAACGGA
CTGAGTGGCGGTGCTAATGGCGGCGTTGGAACCCTGGGTGGTGCTAATGG
AGCCGGTGGCTTTAATGCTGTCGGTGGAGCTAACGGTGGGCCGAATGGCA
GCCCAAATGCCGCGACAAATGTGCCTCAGGGTCATGATCCCAACAACAGC
ACACAGGTCACCATTCCAAAAGAGCTGGCTGGTGCCATCATTGGTAAGGG
AGGTGGCCGCATCCGTCGCATCCGCAACGAGTCCAGTGCGTACATCACCA
TCGACGAGCCCCTGCCAAACTCGAACGATCGTATCATCACCATCTCGGGC
ACGCCGAAGCAAATACAAATGGCCCAGTATCTGCTGCAACAGAGCGTACA
CGAGAATGGCAGGCGAAACATTGCAAGCTTTCTAGACCAT

BO27645.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
bl-RC 1509 CG13425-PC 1..1506 17..1522 7530 100 Plus
bl-RF 1491 CG13425-PF 1..1488 35..1522 7440 100 Plus
bl-RA 1491 CG13425-PA 1..1488 35..1522 7440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
bl-RC 2127 CG13425-RC 237..1744 15..1522 7540 100 Plus
bl-RF 2078 CG13425-RF 197..1695 24..1522 7495 100 Plus
bl-RA 2076 CG13425-RA 195..1693 24..1522 7495 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20604696..20605623 401..1328 4625 99.9 Plus
2R 25286936 2R 20605680..20605851 1323..1494 860 100 Plus
2R 25286936 2R 20595557..20595663 24..130 535 100 Plus
2R 25286936 2R 20598597..20598694 303..400 490 100 Plus
2R 25286936 2R 20598452..20598525 231..304 370 100 Plus
2R 25286936 2R 20595758..20595814 131..187 285 100 Plus
2R 25286936 2R 20597545..20597591 185..231 235 100 Plus
Blast to na_te.dros performed 2014-11-28 02:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
aurora-element 4263 aurora-element DMAURA 4263bp Derived from AB022762 (d1268008) (Rel. 59, Last updated, Version 1). 3655..3701 1145..1099 127 74.5 Minus

BO27645.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:07 Download gff for BO27645.complete
Subject Subject Range Query Range Percent Splice Strand
bl-RC 285..1790 17..1524 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:08 Download gff for BO27645.complete
Subject Subject Range Query Range Percent Splice Strand
bl-RC 239..1744 17..1524 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:49 Download gff for BO27645.complete
Subject Subject Range Query Range Percent Splice Strand
bl-RC 239..1744 17..1524 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:49 Download gff for BO27645.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20606444..20606471 1495..1524 93   Plus
2R 20605682..20605851 1325..1494 100 -> Plus
2R 20604696..20605619 401..1324 100 -> Plus
2R 20598599..20598694 305..400 100 -> Plus
2R 20598453..20598525 232..304 100 -> Plus
2R 20597548..20597591 188..231 100 -> Plus
2R 20595758..20595814 131..187 100 -> Plus
2R 20595550..20595663 17..130 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:08 Download gff for BO27645.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16493949..16493976 1495..1524 93   Plus
arm_2R 16493187..16493356 1325..1494 100 -> Plus
arm_2R 16492201..16493124 401..1324 100 -> Plus
arm_2R 16486104..16486199 305..400 100 -> Plus
arm_2R 16485958..16486030 232..304 100 -> Plus
arm_2R 16485053..16485096 188..231 100 -> Plus
arm_2R 16483263..16483319 131..187 100 -> Plus
arm_2R 16483055..16483168 17..130 97 -> Plus

BO27645.pep Sequence

Translation from 16 to 1540

> BO27645.pep
MTKRLRMKREMNDEGEGPQDQKRNRRNEETVRILIPSSIAGAVIGKGGQH
IQKMRTQYKATVSVDDSQGPERTIQISADIESTLEIITEMLKYFEERDED
FDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVV
QTVGKQSQVIEAVREVITLTRDTPIKGAIHNYDPMNFDRVYADEYGGYGT
GSGSTRPSQRGNNRNGGGAGGVAGGAAGGNGGGFNAGGARGNAGGRGGAD
RFGGAAGGAVAGAGMGQRDNPFINPWANGGGGDVDGFGNNAGGAGGFAGN
SFGGGAGGPFGGGSFGNNGFGGGPSDFGGNSGNFGQAQGTNSLPSLGSFS
QNQGGTSSLPSLGSFGQNPGGPGGLGNGLSGGANGGVGTLGGANGAGGFN
AVGGANGGPNGSPNAATNVPQGHDPNNSTQVTIPKELAGAIIGKGGGRIR
RIRNESSAYITIDEPLPNSNDRIITISGTPKQIQMAQYLLQQSVHENGRR
NIASFLDH

BO27645.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
bl-PC 502 CG13425-PC 1..502 1..502 2644 100 Plus
bl-PF 496 CG13425-PF 1..496 7..502 2615 100 Plus
bl-PA 496 CG13425-PA 1..496 7..502 2615 100 Plus
bl-PE 493 CG13425-PE 1..486 7..492 2562 100 Plus
bl-PB 413 CG13425-PB 1..413 90..502 2200 100 Plus