Clone BO27648 Report

Search the DGRC for BO27648

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:276
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptDsp1-RF
Protein status:BO27648.pep: Imported from assembly
Sequenced Size:1225

Clone Sequence Records

BO27648.complete Sequence

1225 bp assembled on 2010-08-18

GenBank Submission: KX794155

> BO27648.complete
GAAGTTATCAGTCGACATGCTAATGAACATCCATCAACCAACTATTGATC
AGCAAACAATTCAACACTATCAGCAGCAATTGGCTGCTCAGCAACAACAA
CAAGTACAACAGCAACAGTTGCAACAACACCAGGTGGTCGTCCAGCAGAA
TCAGCAGCAGGCGCACCAGAACAGCTCCAATACCACAGCCGGCGTGGGCA
CCCAACAGCTGTTCACATACAAAATGGCCAGCAGTTTTCCGAATCCGGCC
ACGACGATGGCCCAAGTGGTGGCCACATCGAACGCAGCCGGCACCACGGG
CTATGATTATCGTCTAAATATGGCACAGGCAGCCGCAGCAGCAGCCGTAC
CCGGCTCCCAGTGGTGGTATTCGGCCGCCAATCAGGGACAGGTCGATGCC
AATACAGCGGCGCAACTGCAGCACCAGCAGCAGCAACAGCAACAGCAACA
ACAGCAGCAGCAGCAACAGCACCAGCAGCAACAACAGATGCAACAGCAGC
AGCAGCAACAGAATGTCATCAATTCGGCGAGCCCCATGAGCAGAGTCAAG
GCCGATGCCAAGCCCAGAGGCCGAATGACCGCCTACGCATACTTTGTACA
AACTTGCAGAGAGGAGCACAAAAAGAAACATCCCGATGAGACGGTGATAT
TCGCCGAATTCTCGCGGAAGTGCGCCGAACGGTGGAAGACAATGGTGGAC
AAGGAGAAGAAGCGCTTCCACGAAATGGCCGAGAAGGACAAGCAGCGATA
TGAGGCGGAAATGCAGAACTATGTGCCGCCCAAGGGAGCGGTTGTGGGAC
GCGGCAAGAAGAGGAAACAGATCAAGGACCCCAATGCTCCAAAACGTTCA
TTGTCTGCGTTCTTCTGGTTCTGCAATGACGAGAGAAATAAGGTGAAGGC
ACTTAATCCCGAGTTCGGAGTGGGCGACATCGCCAAAGAGCTGGGACGAA
AGTGGTCCGATGTGGATCCCGAGGTCAAGCAGAAGTACGAGTCGATGGCC
GAGCGGGACAAGGCTCGATATGAACGCGAGATGACCGAGTACAAGACGAG
CGGGAAAATAGCCATGTCCGCACCGTCGATGCAGGCGTCGATGCAGGCGC
AGGCACAGAAAGCCGCGTTACTTGCCGCCGCTGCCCAGCAGCAGCACCAG
CAGCTGGAAGAGCAGCACGACGACGACGACGGCGATGGAGATGATGACGA
GAACCAAGCAAGCTTTCTAGACCAT

BO27648.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:42:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsp1-RF 1194 CG12223-PF 1..1191 17..1207 5955 100 Plus
Dsp1-RE 1182 CG12223-PE 22..1179 50..1207 5790 100 Plus
Dsp1-RG 1161 CG12223-PG 22..1158 71..1207 5685 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:42:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsp1-RF 2205 CG12223-RF 48..1238 17..1207 5955 100 Plus
Dsp1-RE 4240 CG12223-RE 263..1420 50..1207 5790 100 Plus
Dsp1-RG 2359 CG12223-RG 143..1279 71..1207 5685 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16336231..16336743 17..529 2565 100 Plus
X 23542271 X 16337625..16337804 1028..1207 900 100 Plus
X 23542271 X 16337381..16337556 853..1028 880 100 Plus
X 23542271 X 16337084..16337251 687..854 840 100 Plus
X 23542271 X 16336850..16337009 529..688 800 100 Plus
Blast to na_te.dros performed 2014-11-28 02:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2398..2854 48..513 344 57 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2334..2837 32..511 297 58.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6831 1094..1170 123 65.4 Plus

BO27648.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:08 Download gff for BO27648.complete
Subject Subject Range Query Range Percent Splice Strand
Dsp1-RF 44..1234 17..1209 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:11 Download gff for BO27648.complete
Subject Subject Range Query Range Percent Splice Strand
Dsp1-RF 48..1238 17..1209 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:51 Download gff for BO27648.complete
Subject Subject Range Query Range Percent Splice Strand
Dsp1-RF 48..1238 17..1209 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:51 Download gff for BO27648.complete
Subject Subject Range Query Range Percent Splice Strand
X 16337625..16337804 1028..1209 98   Plus
X 16337381..16337555 853..1027 100 -> Plus
X 16337086..16337249 689..852 100 -> Plus
X 16336851..16337009 530..688 100 -> Plus
X 16336231..16336743 17..529 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:11 Download gff for BO27648.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16231658..16231837 1028..1209 98   Plus
arm_X 16231414..16231588 853..1027 100 -> Plus
arm_X 16231119..16231282 689..852 100 -> Plus
arm_X 16230884..16231042 530..688 100 -> Plus
arm_X 16230264..16230776 17..529 100 -> Plus

BO27648.pep Sequence

Translation from 16 to 1225

> BO27648.pep
MLMNIHQPTIDQQTIQHYQQQLAAQQQQQVQQQQLQQHQVVVQQNQQQAH
QNSSNTTAGVGTQQLFTYKMASSFPNPATTMAQVVATSNAAGTTGYDYRL
NMAQAAAAAAVPGSQWWYSAANQGQVDANTAAQLQHQQQQQQQQQQQQQQ
QHQQQQQMQQQQQQQNVINSASPMSRVKADAKPRGRMTAYAYFVQTCREE
HKKKHPDETVIFAEFSRKCAERWKTMVDKEKKRFHEMAEKDKQRYEAEMQ
NYVPPKGAVVGRGKKRKQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEF
GVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYEREMTEYKTSGKIAM
SAPSMQASMQAQAQKAALLAAAAQQQHQQLEEQHDDDDGDGDDDENQASF
LDH

BO27648.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsp1-PF 397 CG12223-PF 1..397 1..397 2067 100 Plus
Dsp1-PE 393 CG12223-PE 8..393 12..397 2008 100 Plus
Dsp1-PG 386 CG12223-PG 8..386 19..397 1969 100 Plus
Dsp1-PD 386 CG12223-PD 8..386 19..397 1969 100 Plus
Dsp1-PC 385 CG12223-PC 5..385 17..397 1968 99.5 Plus
Dsp1-PE 393 CG12223-PE 118..338 6..252 171 23.4 Plus
Dsp1-PG 386 CG12223-PG 111..331 6..252 171 23.4 Plus
Dsp1-PD 386 CG12223-PD 111..331 6..252 171 23.4 Plus
Dsp1-PG 386 CG12223-PG 6..241 125..342 166 23.2 Plus
Dsp1-PD 386 CG12223-PD 6..241 125..342 166 23.2 Plus