Clone BO27659 Report

Search the DGRC for BO27659

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:276
Well:59
Vector:pDNR-Dual
Associated Gene/TranscriptCp1-RC
Protein status:BO27659.pep: Imported from assembly
Sequenced Size:1147

Clone Sequence Records

BO27659.complete Sequence

1147 bp assembled on 2010-08-18

GenBank Submission: KX795620

> BO27659.complete
GAAGTTATCAGTGGACATGAATCACCTTGGCGTTTTTGAAACCCGTTTTC
GCCCTCGAACTAGGCACAAATCGCAGAGGGCACAATTGATTCCAGAACAA
ATCACAATGCGCACAGCTGTTTTGCTGCCACTTTTGGCCCTGCTGGCGGT
GGCTCAGGCCGTTTCCTTCGCCGACGTGGTCATGGAGGAATGGCATACGT
TCAAGCTGGAGCACCGCAAGAACTATCAGGATGAAACCGAGGAGCGTTTC
CGCCTCAAGATCTTCAATGAGAACAAGCACAAGATTGCCAAGCACAACCA
GCGATTCGCCGAGGGCAAGGTGAGCTTCAAACTGGCGGTCAATAAGTACG
CCGATTTGCTGCACCACGAATTCCGTCAGCTGATGAACGGCTTCAACTAC
ACTCTGCACAAGCAACTGCGTGCCGCCGATGAAAGCTTCAAGGGAGTCAC
CTTCATCTCGCCGGCTCATGTGACGCTGCCCAAATCTGTGGACTGGCGCA
CCAAGGGAGCTGTGACCGCCGTCAAGGATCAGGGACACTGCGGCAGCTGC
TGGGCCTTCTCCAGCACAGGCGCCCTCGAGGGTCAGCATTTCCGCAAGTC
CGGTGTCCTCGTCTCGCTGTCCGAGCAGAATCTGGTCGATTGCTCCACCA
AGTACGGCAACAATGGATGCAACGGCGGTCTCATGGACAATGCCTTCCGC
TATATTAAGGATAATGGAGGCATCGATACCGAGAAGTCCTATCCCTACGA
GGCCATCGATGACTCGTGCCACTTTAACAAGGGCACAGTCGGAGCCACCG
ATCGTGGATTCACCGATATTCCCCAGGGTGATGAGAAGAAGATGGCCGAG
GCTGTGGCCACCGTTGGTCCCGTTTCCGTCGCCATCGATGCCTCCCACGA
GTCGTTCCAGTTCTACTCGGAGGGCGTCTACAACGAGCCGCAGTGTGATG
CCCAGAATCTGGATCACGGTGTGCTGGTCGTTGGCTTCGGCACCGACGAG
TCCGGCGAGGATTACTGGCTGGTGAAGAACTCGTGGGGCACCACCTGGGG
CGACAAGGGCTTCATCAAGATGCTGCGCAACAAGGAGAACCAGTGCGGCA
TCGCTAGCGCCTCCAGCTATCCCCTGGTCGCAAGCTTTCTAGACCAT

BO27659.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
Cp1-RC 1116 CG6692-PC 1..1113 17..1129 5565 100 Plus
Cp1-RA 1026 CG6692-PA 1..1023 107..1129 5115 100 Plus
Cp1-RE 1017 CG6692-PE 90..1014 205..1129 4625 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
Cp1-RC 1369 CG6692-RC 14..1126 17..1129 5565 100 Plus
Cp1-RA 1486 CG6692-RA 201..1243 87..1129 5215 100 Plus
Cp1-RD 1481 CG6692-RD 313..1238 204..1129 4630 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13967029..13967738 420..1129 3550 100 Plus
2R 25286936 2R 13966753..13966969 204..420 1085 100 Plus
2R 25286936 2R 13962219..13962336 88..205 590 100 Plus
2R 25286936 2R 13961194..13961265 17..88 360 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:42:17 has no hits.

BO27659.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:05 Download gff for BO27659.complete
Subject Subject Range Query Range Percent Splice Strand
Cp1-RC 14..1126 17..1131 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:05 Download gff for BO27659.complete
Subject Subject Range Query Range Percent Splice Strand
Cp1-RC 14..1126 17..1131 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:47 Download gff for BO27659.complete
Subject Subject Range Query Range Percent Splice Strand
Cp1-RC 14..1126 17..1131 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:47 Download gff for BO27659.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13967030..13967738 421..1131 99   Plus
2R 13966755..13966969 206..420 100 -> Plus
2R 13962220..13962336 89..205 100 -> Plus
2R 13961194..13961265 17..88 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:05 Download gff for BO27659.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9854535..9855243 421..1131 99   Plus
arm_2R 9854260..9854474 206..420 100 -> Plus
arm_2R 9849725..9849841 89..205 100 -> Plus
arm_2R 9848699..9848770 17..88 100 -> Plus

BO27659.pep Sequence

Translation from 16 to 1147

> BO27659.pep
MNHLGVFETRFRPRTRHKSQRAQLIPEQITMRTAVLLPLLALLAVAQAVS
FADVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQRFAEG
KVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTFISPA
HVTLPKSVDWRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSGVLVS
LSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEAIDDS
CHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHESFQFY
SEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGDKGFI
KMLRNKENQCGIASASSYPLVASFLDH

BO27659.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
Cp1-PC 371 CG6692-PC 1..371 1..371 1979 100 Plus
Cp1-PA 341 CG6692-PA 1..341 31..371 1822 100 Plus
Cp1-PE 338 CG6692-PE 31..338 64..371 1661 100 Plus
Cp1-PD 249 CG6692-PD 1..249 123..371 1349 100 Plus
CG4847-PE 390 CG4847-PE 79..390 56..371 621 41.7 Plus