Clone BO27667 Report

Search the DGRC for BO27667

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:276
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptCG3192-RA
Protein status:BO27667.pep: Imported from assembly
Sequenced Size:559

Clone Sequence Records

BO27667.complete Sequence

559 bp assembled on 2010-08-18

GenBank Submission: KX800037

> BO27667.complete
GAAGTTATCAGTCGACATGTCGGCGTTTGTGAAAACCGTGTGCTTGGCCC
AAAAGCTGTGCGCCGCCAATCCCGTCGTGGCTCGCCAGGCGATCCGCAGC
ATGGCTGGCTGGAATAAGGACTACAAGCCGGGTCCGTATCCACAGACGGA
GAAGGAGCGCCTGGCGGCGGCCAAGAAGTACTATCTGTTGCCGGAGGAGT
ACAAACCGTATGCGGACGATGGTCTGGGCTACGGAGATTATCCCAAATTG
GGCTACGGTCTGGGTGTGGAGGCCAAGGACTCGTACTATCCCTGGGACTA
TCCGGAGCACAAGCGCAACCAACACGAGCCCATCTCGGCGGATCATGATC
TGTACAGCGAGGATCGCTGGTCGCAGGCCGAACCGCCACGCTACAGCAAT
GCGTACTACTTTGCCTGCTTCCTGGGCGTGATGTCCGGCTGCCTGGCACT
CTACTACTGGCTGGATGACAAGAAGATGTACCGCCCCGTGGCCGCCAAGC
AATATCCCAGCCCTGGCGTCAAGCACTACACCTTCGAGAAGGCAAGCTTT
CTAGACCAT

BO27667.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG3192-RC 528 CG3192-PC 1..525 17..541 2625 100 Plus
CG3192-RB 528 CG3192-PB 1..525 17..541 2625 100 Plus
CG3192-RA 528 CG3192-PA 1..525 17..541 2625 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG3192-RC 706 CG3192-RC 78..602 17..541 2625 100 Plus
CG3192-RB 805 CG3192-RB 177..701 17..541 2625 100 Plus
CG3192-RA 1321 CG3192-RA 693..1217 17..541 2625 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6677652..6677881 331..102 1150 100 Minus
X 23542271 X 6677366..6677575 541..332 1050 100 Minus
X 23542271 X 6678000..6678084 101..17 425 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:42:11 has no hits.

BO27667.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:04 Download gff for BO27667.complete
Subject Subject Range Query Range Percent Splice Strand
CG3192-RA 693..1217 17..543 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:03 Download gff for BO27667.complete
Subject Subject Range Query Range Percent Splice Strand
CG3192-RA 693..1217 17..543 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:44 Download gff for BO27667.complete
Subject Subject Range Query Range Percent Splice Strand
CG3192-RA 693..1217 17..543 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:44 Download gff for BO27667.complete
Subject Subject Range Query Range Percent Splice Strand
X 6678000..6678084 17..101 100   Minus
X 6677652..6677881 102..331 100 <- Minus
X 6677364..6677575 332..543 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:03 Download gff for BO27667.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6572033..6572117 17..101 100   Minus
arm_X 6571685..6571914 102..331 100 <- Minus
arm_X 6571397..6571608 332..543 99 <- Minus

BO27667.pep Sequence

Translation from 16 to 559

> BO27667.pep
MSAFVKTVCLAQKLCAANPVVARQAIRSMAGWNKDYKPGPYPQTEKERLA
AAKKYYLLPEEYKPYADDGLGYGDYPKLGYGLGVEAKDSYYPWDYPEHKR
NQHEPISADHDLYSEDRWSQAEPPRYSNAYYFACFLGVMSGCLALYYWLD
DKKMYRPVAAKQYPSPGVKHYTFEKASFLDH

BO27667.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG3192-PC 175 CG3192-PC 1..175 1..175 978 100 Plus
CG3192-PB 175 CG3192-PB 1..175 1..175 978 100 Plus
CG3192-PA 175 CG3192-PA 1..175 1..175 978 100 Plus