Clone BO27678 Report

Search the DGRC for BO27678

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:276
Well:78
Vector:pDNR-Dual
Associated Gene/Transcriptgus-RB
Protein status:BO27678.pep: full length peptide match
Sequenced Size:1063

Clone Sequence Records

BO27678.complete Sequence

1063 bp assembled on 2010-08-18

GenBank Submission: KX799210

> BO27678.complete
GAAGTTATCAGTCGACATGTATAAGGGTGGTCGGACACCTTCTATTAGGT
CCAGTGAAAGGCGTCGTCCTCAAAGTGTTTCATCTATATCCACACTATCC
CCGAGAGTTGTTTTGTCCAGATTGGAGCCGAGGGAGTTTGAACGTCTTCG
ACTATCCTACAAAATTGCAATCGACCAAAGAAGATCCAGAAGCTGCCGTG
GCATGAACATGGGTCAAAAAATTAGTGGCGGAGTCAAAACAGTTAGTCGC
AATGATTCACAGTCTACATTTAAACCAATAATACCAAGAGAGTTGCAAGC
TGATTTCGTTAAACCAGCGCGAATCGATATATTACTTGATATGCCGCCAG
CATCTCGAGATCTTCAATTGAAGCATTCATGGAACTCCGAAGATCGGTCT
CTTAACATTTTTGTAAAAGAGGACGACAAGTTGACATTTCATAGGCACCC
AGTGGCTCAAAGTACTGACTGTATTCGCGGAAAAGTCGGACTTACAAAGG
GATTGCATATTTGGGAAATTTATTGGCCAACAAGGCAAAGAGGAACCCAC
GCTGTTGTTGGCGTATGCACTGCAGATGCACCTTTACATTCAGTTGGCTA
CCAAAGTTTAGTTGGATCAACTGAACAAAGTTGGGGCTGGGACTTAGGAA
GAAATAAATTATACCATGACTCAAAAAACTGCGCTGGAGTGACATATCCA
GCAATTCTTAAAAACGACGAAGCTTTTTTAGTTCCAGATAAGTTCTTAGT
AGCGTTAGATATGGACGAAGGAACACTAAGCTTCATTGTTGATCAGCAGT
ACCTCGGTATTGCGTTTAGAGGACTGCGAGGGAAAAAACTATATCCAATT
GTTTCGGCGGTCTGGGGACACTGTGAAATAACAATGCGTTACATTGGTGG
ATTAGATCCCGAACCCTTGCCCCTAATGGATCTTTGCCGAAGAACAATTC
GTCAAAAAATTGGTCGCACAAACTTGGAGGAGCACATTCAACAGCTTCAA
CTTCCTTTATCAATGAAAACATATTTATTGTATAAAAACCGTAGAGCAAG
CTTTCTAGACCAT

BO27678.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
gus-RM 840 CG2944-PM 1..837 209..1045 4185 100 Plus
gus-RL 840 CG2944-PL 1..837 209..1045 4185 100 Plus
gus-RK 840 CG2944-PK 1..837 209..1045 4185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
gus-RM 1525 CG2944-RM 163..1191 17..1045 5145 100 Plus
gus-RK 1813 CG2944-RK 332..1360 17..1045 5145 100 Plus
gus-RJ 1730 CG2944-RJ 368..1396 17..1045 5145 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5120763..5121652 908..19 4450 100 Minus
2R 25286936 2R 5117666..5117802 1045..909 685 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:42:05 has no hits.

BO27678.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:03 Download gff for BO27678.complete
Subject Subject Range Query Range Percent Splice Strand
gus-RB 86..1114 17..1047 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:01 Download gff for BO27678.complete
Subject Subject Range Query Range Percent Splice Strand
gus-RJ 368..1396 17..1047 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:42 Download gff for BO27678.complete
Subject Subject Range Query Range Percent Splice Strand
gus-RJ 368..1396 17..1047 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:42 Download gff for BO27678.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5120763..5121654 17..908 99   Minus
2R 5117664..5117802 909..1047 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:01 Download gff for BO27678.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1008268..1009159 17..908 99   Minus
arm_2R 1005169..1005307 909..1047 98 <- Minus

BO27678.pep Sequence

Translation from 16 to 1063

> BO27678.pep
MYKGGRTPSIRSSERRRPQSVSSISTLSPRVVLSRLEPREFERLRLSYKI
AIDQRRSRSCRGMNMGQKISGGVKTVSRNDSQSTFKPIIPRELQADFVKP
ARIDILLDMPPASRDLQLKHSWNSEDRSLNIFVKEDDKLTFHRHPVAQST
DCIRGKVGLTKGLHIWEIYWPTRQRGTHAVVGVCTADAPLHSVGYQSLVG
STEQSWGWDLGRNKLYHDSKNCAGVTYPAILKNDEAFLVPDKFLVALDMD
EGTLSFIVDQQYLGIAFRGLRGKKLYPIVSAVWGHCEITMRYIGGLDPEP
LPLMDLCRRTIRQKIGRTNLEEHIQQLQLPLSMKTYLLYKNRRASFLDH

BO27678.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
gus-PM 279 CG2944-PM 1..279 65..343 1486 100 Plus
gus-PL 279 CG2944-PL 1..279 65..343 1486 100 Plus
gus-PK 279 CG2944-PK 1..279 65..343 1486 100 Plus
gus-PJ 279 CG2944-PJ 1..279 65..343 1486 100 Plus
gus-PI 279 CG2944-PI 1..279 65..343 1486 100 Plus