Clone BO27685 Report

Search the DGRC for BO27685

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:276
Well:85
Vector:pDNR-Dual
Associated Gene/Transcriptflr-RB
Protein status:BO27685.pep: Imported from assembly
Sequenced Size:1846

Clone Sequence Records

BO27685.complete Sequence

1846 bp assembled on 2010-09-13

GenBank Submission: KX795986

> BO27685.complete
GAAGTTATCAGTCGACATGAGTCAACAGGCGAAAAACGAAAACATCTACG
CAACTCTGCCGCGCACCCAACGCGGCCAACCCATCGTTTTGGGTGCCGAT
CCCAAGGGCAAGAACTTCCTGTACACCAATGGAAACTCTGTGATCATCCG
GAACATCGAGAATCCAGCCATTGCCGATGTCTACACGGAGCACTCGTGTG
CAGTGAACGTGGCCAAGTACTCGCCCAGCGGATTTTATATTGCATCTGGT
GACGCCTCCGGCAAGATTCGCATTTGGGACACGGTCAACAAGGAGCACCT
GCTTAAAAATGAGTTCCAGCCCATTGCAGGACCCATCAAGGATATTAGCT
GGTCGCCAGACAATCAGCGCATCGTTGCCGTGGGTGAAGGACGCGAACGT
TTCGGTCATGTCTTTATGTCTGAAACCGGCACGTCTGTGGGCGAGATCAG
TGGCCAGTCCAAGTCTATTAACTCGGCGGACTTCCGGCCAGCCAGGCCAT
TCCGCATTGTTACGGGCAGCGAAGACAATACTATCGCCGTGTTCGAGGGA
CCCCCGTTCAAGTTCAAGATGACCAAGCAGGATCACTCTCGCTTCGTCCA
GGCTGTGCGCTACTCGCCCGATGGCAAATTCTTCGCCTCCGCCGGCTTTG
ATGGCAAAGTCTTTCTGTACGATGGCACCAGCTCTGAACTGGTGGGCGAA
TTTGGATCTCCTGCCCACAAGGGCGGCGTTTACGCATTGGCCTGGAAACC
AGACAGCACCCAACTGCTAACCTGCTCCGGCGACAAGACGTGCCGCCTTT
GGACAGTGGAGTCGCGCGAGCTGGTTAGCGAGTTTGTGATGGGCACCACT
GTGGACGACCAGCAGGTGTCCTGCTTGTGGCAAGGAGACAACCTAATCAC
CGTCTCGCTTTCGGGCGTGATCACCTACCTCAATGTGGCGGATCCCTCGA
AACCGCTGCGTGTGGTGAAGGGCCACAATAAGCCCATCACCGTGCTGGGA
CTGAGCGATGACCGCAGCACCATATACACGGGTAGCCACGATGGCGTGGT
GACCAACTGGAACTCGGGCAGCGGCACCAACGATCGCATCACGGGCACTG
GACACGGAAACCAGATCAACGGCATTGCCGCCTGGGGTGACTTTGTCTAT
ACCTGTGGCATCGACGACAGCCTACGCCAGTTCAGCGTGGAGGGCAACTC
CTACACGGACTATGTGGTGAAGCTTAACTGCCAGCCACGTGGCTTGGCCA
TTTTGCGCAACGAGAACATCATTGCACTTGCTTGCATCAAAGAGTTGACT
CTCGTGCAGGACCAGAAGAAGATCTTTTCGCTGCCCATTAAGTACGAGGC
TAGCTCGATTGCCGTTAATGCGGACACTTCCGATGTTGCTGTCGGCGGGG
ATGACCAAAAGTTGCACATCTACACCCTGAAGGGCGGAGTATTGGAGCCC
AAAGTGGAGCTGGATCACTTGGGAGCTGTCACGGATGTTTCTTATTCGCC
GGACTTGAAGTATTTGGTGGCTTGCGATGCCCATCGCAAGGTGGTGCTCT
ACTCAGTGGAGGAGTACAAGCCTGCACACAACAAGGAGTGGGGCTTCCAC
AGTGCTCGCGTAAATACGGTGGCCTGGTCGCCCAACTCGCTGCTGGTTGC
TAGTGGATCATTGGACACTACTATCATTATCTGGTCCGTGGCCAATCCGG
CCAAACATACTATCATCAAGAATGCCCATCCGCAGTCGCAAATCACTCGG
TTGGTCTGGCTGGACAATAACACTGTGATCTCCACCGGACAGGACTGCAA
CACCAAGGTGTGGCACGTGGAAAACATTGCAAGCTTTCTAGACCAT

BO27685.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
flr-RB 1815 CG10724-PB 1..1812 17..1828 9060 100 Plus
flr-RA 1827 CG10724-PA 29..1824 33..1828 8965 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
flr-RB 2210 CG10724-RB 47..1858 17..1828 9060 100 Plus
flr-RA 2275 CG10724-RA 128..1923 33..1828 8965 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13414660..13415720 510..1570 5290 99.9 Plus
3L 28110227 3L 13414336..13414601 251..516 1330 100 Plus
3L 28110227 3L 13415774..13415927 1568..1721 770 100 Plus
3L 28110227 3L 13413316..13413438 38..160 615 100 Plus
3L 28110227 3L 13415995..13416101 1722..1828 535 100 Plus
3L 28110227 3L 13414056..13414148 159..251 465 100 Plus
Blast to na_te.dros performed on 2014-11-28 05:02:45 has no hits.

BO27685.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:37 Download gff for BO27685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10724-RB 47..1858 17..1830 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:25:11 Download gff for BO27685.complete
Subject Subject Range Query Range Percent Splice Strand
flr-RB 47..1858 17..1830 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:02:58 Download gff for BO27685.complete
Subject Subject Range Query Range Percent Splice Strand
flr-RB 47..1858 17..1830 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:02:58 Download gff for BO27685.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13415995..13416101 1722..1830 98   Plus
3L 13415777..13415927 1571..1721 100 -> Plus
3L 13414666..13415720 516..1570 100 -> Plus
3L 13414337..13414600 252..515 100 -> Plus
3L 13414058..13414148 161..251 100 -> Plus
3L 13413317..13413438 39..160 100 -> Plus
3L 13413052..13413073 17..38 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:25:11 Download gff for BO27685.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13409095..13409201 1722..1830 98   Plus
arm_3L 13408877..13409027 1571..1721 100 -> Plus
arm_3L 13407766..13408820 516..1570 100 -> Plus
arm_3L 13407437..13407700 252..515 100 -> Plus
arm_3L 13407158..13407248 161..251 100 -> Plus
arm_3L 13406417..13406538 39..160 100 -> Plus
arm_3L 13406152..13406173 17..38 100 -> Plus

BO27685.pep Sequence

Translation from 16 to 1846

> BO27685.pep
MSQQAKNENIYATLPRTQRGQPIVLGADPKGKNFLYTNGNSVIIRNIENP
AIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEHLLKNEF
QPIAGPIKDISWSPDNQRIVAVGEGRERFGHVFMSETGTSVGEISGQSKS
INSADFRPARPFRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYS
PDGKFFASAGFDGKVFLYDGTSSELVGEFGSPAHKGGVYALAWKPDSTQL
LTCSGDKTCRLWTVESRELVSEFVMGTTVDDQQVSCLWQGDNLITVSLSG
VITYLNVADPSKPLRVVKGHNKPITVLGLSDDRSTIYTGSHDGVVTNWNS
GSGTNDRITGTGHGNQINGIAAWGDFVYTCGIDDSLRQFSVEGNSYTDYV
VKLNCQPRGLAILRNENIIALACIKELTLVQDQKKIFSLPIKYEASSIAV
NADTSDVAVGGDDQKLHIYTLKGGVLEPKVELDHLGAVTDVSYSPDLKYL
VACDAHRKVVLYSVEEYKPAHNKEWGFHSARVNTVAWSPNSLLVASGSLD
TTIIIWSVANPAKHTIIKNAHPQSQITRLVWLDNNTVISTGQDCNTKVWH
VENIASFLDH

BO27685.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
flr-PB 604 CG10724-PB 1..604 1..604 3182 100 Plus
flr-PA 608 CG10724-PA 10..608 6..604 3151 99.7 Plus
Nle-PA 488 CG2863-PA 117..486 146..599 240 23.3 Plus
Poc1-PA 391 CG10191-PA 7..305 49..356 238 23.3 Plus
Poc1-PB 403 CG10191-PB 7..305 49..356 238 23.3 Plus