Clone BO27692 Report

Search the DGRC for BO27692

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:276
Well:92
Vector:pDNR-Dual
Associated Gene/TranscriptPu-RB
Protein status:BO27692.pep: Imported from assembly
Sequenced Size:853

Clone Sequence Records

BO27692.complete Sequence

853 bp assembled on 2010-08-18

GenBank Submission: KX800073

> BO27692.complete
GAAGTTATCAGTCGACATGAAGCCCCAGACAAGCGAGCAAAATGGCAGTG
GCCAAAATGGCGAGGGTGCCGCAGATGCCGTGGCCGTTGCCACGATCCCC
ACGGGCGAAGCCTCCGCCGCCTCCGCCACGTCCGGCACCGATCTAACGGT
CTCCAAAAACAGCCAGCAGCTGAAACTGGAAATGCTCAACTTGGAGCTGG
CCAGCAATGGAAGCGGCCACGAGAAGTGCACGTTCCACCACGACCTGGAG
CTGGACCACAAGCCGCCGACGCGAGAGGCCCTCCTTCCGGACATGGCACG
CTCGTATCGTCTACTCTTGGGCGGCCTGGGCGAGAATCCCGATCGCCAGG
GACTGATCAAGACGCCGGAGCGGGCAGCCAAGGCCATGCTGTACTTCACC
AAGGGCTACGACCAGAGTCTCGAGGATGTTCTCAATGGCGCCGTTTTCGA
CGAGGATCATGACGAAATGGTGGTGGTCAAGGATATTGAAATGTTCTCCA
TGTGCGAGCATCATCTGGTGCCCTTCTACGGCAAAGTTTCCATCGGTTAT
TTGCCGTGCAACAAGATTCTCGGACTCAGTAAATTGGCACGCATTGTCGA
AATATTTTCGCGTCGCCTGCAAGTCCAGGAGCGCTTAACTAAGCAGATCG
CAGTGGCCGTGACTCAGGCCGTGCAACCCGCTGGAGTAGCAGTGGTCGTA
GAGGGAGTCCACATGTGCATGGTGATGCGTGGCGTGCAGAAGATCAACAG
CAAAACTGTTACCTCAACTATGCTGGGCGTGTTCCGAGACGATCCCAAGA
CCCGTGAGGAATTCCTGAACTTAGTCAATAGCAAAGCAAGCTTTCTAGAC
CAT

BO27692.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-RB 822 CG9441-PB 1..819 17..835 4095 100 Plus
Pu-RA 975 CG9441-PA 352..972 215..835 3105 100 Plus
Pu-RC 927 CG9441-PC 304..924 215..835 3105 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-RB 1625 CG9441-RB 159..979 15..835 4105 100 Plus
Pu-RA 1793 CG9441-RA 527..1147 215..835 3105 100 Plus
Pu-RC 1744 CG9441-RC 478..1098 215..835 3105 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21179937..21180147 215..425 1055 100 Plus
2R 25286936 2R 21175473..21175674 15..216 1010 100 Plus
2R 25286936 2R 21181419..21181585 425..591 835 100 Plus
2R 25286936 2R 21181836..21181962 709..835 635 100 Plus
2R 25286936 2R 21181644..21181761 591..708 590 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:41:54 has no hits.

BO27692.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:01 Download gff for BO27692.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RB 159..977 17..837 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:58 Download gff for BO27692.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RB 161..979 17..837 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:39 Download gff for BO27692.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RB 161..979 17..837 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:39 Download gff for BO27692.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21181836..21181962 709..837 98   Plus
2R 21181645..21181761 592..708 100 -> Plus
2R 21181420..21181585 426..591 100 -> Plus
2R 21179938..21180147 216..425 100 -> Plus
2R 21175475..21175673 17..215 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:58 Download gff for BO27692.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17069341..17069467 709..837 98   Plus
arm_2R 17069150..17069266 592..708 100 -> Plus
arm_2R 17068925..17069090 426..591 100 -> Plus
arm_2R 17067443..17067652 216..425 100 -> Plus
arm_2R 17062980..17063178 17..215 100 -> Plus

BO27692.pep Sequence

Translation from 16 to 853

> BO27692.pep
MKPQTSEQNGSGQNGEGAADAVAVATIPTGEASAASATSGTDLTVSKNSQ
QLKLEMLNLELASNGSGHEKCTFHHDLELDHKPPTREALLPDMARSYRLL
LGGLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLNGAVFDEDHDE
MVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSRR
LQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVTS
TMLGVFRDDPKTREEFLNLVNSKASFLDH

BO27692.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-PB 273 CG9441-PB 1..273 1..273 1389 100 Plus
Pu-PC 308 CG9441-PC 58..308 18..273 1088 85.2 Plus
Pu-PA 324 CG9441-PA 114..324 63..273 1071 98.6 Plus