Clone BO27696 Report

Search the DGRC for BO27696

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:276
Well:96
Vector:pDNR-Dual
Associated Gene/TranscriptCG7059-RD
Protein status:BO27696.pep: Imported from assembly
Sequenced Size:820

Clone Sequence Records

BO27696.complete Sequence

820 bp assembled on 2010-08-18

GenBank Submission: KX794018

> BO27696.complete
GAAGTTATCAGTCGACATGCGCGAAATTCAGGCCTCCCAATTTATGACGA
AAACAAATCGCTTGGTGATTTTGAGGCATGGCGAAAGTGATTTCAACATT
GAGAACAAATTCTGCGGTTGGCATGATGCGCCATTGAGTGAATTCGGCGT
CCAGGAGGCCCTGACTGTGGCGATTCCCGCGCTCGTCCAATCCGAGTTGG
AATTCGACGTGGTCTATTCATCCGTATTGAGCAGATCTCGTCAAACGGCC
GAATTGATACTCTCCAAGTTGAACTGCGCCTATGTGCCCATTAAGGAGGA
TTGGCGGCTGTGCGAAAGGCACTACGGAAATCTGACTGGTTGCCGGAAAC
GAGTGGTAGCCGATCGCTATGGGGAGGAGCAGGTTCAGGCCTGGCGACGT
GGATACGACTGCGTACCGCCGCCCATCGATGAGAAGAACCGCTACTTCTA
CACCATTTGCAGCAATCCCATATTCGATGATGTTCCTCGCGGTGAGTTCC
CCCTCGCGGAATCCCTTCACATGTGCGTCGATCGAGTGAAACCCGTGTGG
AAGGAGGTCAGGCGGGAAGTGTTCCAAGGCACCCGGGTACTAATGTGCGT
CCACGGAACTGTGGCCCGTGCTCTCGTCCAGCACATTGAGGGAATCTCCA
ACGAGGCCATCGAAAAGGTTAACATTCCAAATTGCGTGCCACGCGTCTAT
GAGTTCGATTTGAAAACGGGAGGCTTGGTTGGAGCTGCCATCAATCTGGG
GGATCAGGAGTATATTAGGCGGAAGACAGCCCAGGTGGCAGCCATTGGTG
ACGCAAGCTTTCTAGACCAT

BO27696.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG7059-RD 789 CG7059-PD 1..786 17..802 3930 100 Plus
CG7059-RA 804 CG7059-PA 33..801 34..802 3845 100 Plus
CG7059-RC 762 CG7059-PC 1..759 44..802 3795 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG7059-RD 1261 CG7059-RD 207..992 17..802 3930 100 Plus
CG7059-RC 1238 CG7059-RC 201..969 34..802 3845 100 Plus
CG7059-RA 1332 CG7059-RA 295..1063 34..802 3845 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22391368..22391864 146..642 2485 100 Plus
3R 32079331 3R 22391919..22392080 641..802 810 100 Plus
3R 32079331 3R 22391194..22391307 34..147 570 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:42:00 has no hits.

BO27696.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:02 Download gff for BO27696.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RD 207..992 17..804 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:19:59 Download gff for BO27696.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RD 207..992 17..804 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:40 Download gff for BO27696.complete
Subject Subject Range Query Range Percent Splice Strand
CG7059-RD 207..992 17..804 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:40 Download gff for BO27696.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22391920..22392080 642..804 98   Plus
3R 22391369..22391863 147..641 100 -> Plus
3R 22391194..22391306 34..146 100 -> Plus
3R 22390186..22390202 17..33 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:19:59 Download gff for BO27696.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18217642..18217802 642..804 98   Plus
arm_3R 18217091..18217585 147..641 100 -> Plus
arm_3R 18216916..18217028 34..146 100 -> Plus
arm_3R 18215908..18215924 17..33 100 -> Plus

BO27696.pep Sequence

Translation from 16 to 820

> BO27696.pep
MREIQASQFMTKTNRLVILRHGESDFNIENKFCGWHDAPLSEFGVQEALT
VAIPALVQSELEFDVVYSSVLSRSRQTAELILSKLNCAYVPIKEDWRLCE
RHYGNLTGCRKRVVADRYGEEQVQAWRRGYDCVPPPIDEKNRYFYTICSN
PIFDDVPRGEFPLAESLHMCVDRVKPVWKEVRREVFQGTRVLMCVHGTVA
RALVQHIEGISNEAIEKVNIPNCVPRVYEFDLKTGGLVGAAINLGDQEYI
RRKTAQVAAIGDASFLDH

BO27696.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG7059-PD 262 CG7059-PD 1..262 1..262 1388 100 Plus
CG7059-PA 267 CG7059-PA 12..267 7..262 1360 100 Plus
CG7059-PC 253 CG7059-PC 1..253 10..262 1345 100 Plus
Pglym78-PC 255 CG1721-PC 6..254 15..263 504 41.4 Plus
Pglym78-PB 255 CG1721-PB 6..254 15..263 504 41.4 Plus