Clone BO27705 Report

Search the DGRC for BO27705

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:5
Vector:pDNR-Dual
Associated Gene/TranscriptCG15609-RG
Protein status:BO27705.pep: Imported from assembly
Sequenced Size:2929

Clone Sequence Records

BO27705.complete Sequence

2929 bp assembled on 2010-10-15

GenBank Submission: KX795999

> BO27705.complete
GAAGTTATCAGTCGACATGGCCAGCGTATGGAAGCGATTGCAGCGCAATT
TCAAGCGAGCCGCCAAATTCCAGTTCACCGCATCGTACCACGATCTGCAT
CTGGAAACCACCGCCAAGTGGCGGCCGTCGAACCTCTCTATCGTTTGGAC
CAGAAGATCTAGACGAGTGGCCAGTGCTCCTTTGCCATGGGAGCCGGACA
TGATGAACCCCTTGGTGGGCAATATATCCTGGCCAGTGCCCGACAATCAC
ACCATATCCGTCACCCTGTTTAAGGATCCTCGGACACACGAGCTGGAGGA
CAAGGACTGGACGTTTGTCATCGAAGATGTCACTCCAATGGGCAAGAAAC
GTGTGCTGGCCAATGCCAGCATTAATATGAGGAAGTATGCCAGCATAGAA
TCCACTCAGCAGAGCTTTACCTTGAGCCTAAAGCCAGTCTCGAAGAAGAT
TACTGCAGCCAGTTTGGAGCTCACGATTAGCTGTGTATTTTTGCGAGAAG
GAAAGGCTACAGACGAGGACATGCAGAGCGTTGTCTCCATGATGTCCGTG
AACAACAATGATGTGGCGCCTTTGGATGACTTGGAGGATATTCCAGATCT
TGATGGCTTTAGTGAAATTACGGACAATTTTAATGACTTTACACAGCAAC
TGGAGCATATGACAACTAGCCTAAATGGCTGCATTGATGTGGCCACGCCT
CAAAGTGACGCCGACGGCAAGCGGGAAGCTGCTAACAAGTTAGACTTGCC
CACAGCTGCATCCGGTGGTTCTAGTGGTGCTGAAGAGTCCCTGAAAACGC
CGAATGGATTGCAGCATGTGGTGGACCAAACGCCAATAAAGTCACCAGAT
GAAGTAAAGCAGCCAAAGCAGACGCCGGTGGAGTCATTGAGGTCCAAAAC
TAACGAGGACTTTGACAAAATGGTCACCTCAACGCCACTCGAACCCAACG
TAAACAAGGATGATGTGAAGCCAAAGAAGAAGAGGGCTTTATTCTTCACT
GAGAAGGAGGATGAGCAGGACTTAAGGGTGGAAAGTGTGAAGGAGGATAC
CACCAAGACTATCGGCGACAACAGCACCACTAAGGAAAAGCCCAAAGAAG
AAAGCCAATCCAGTAAGGATGCCTCATCCGTGGTGGTTCCGAGTGCCAAG
CGCCCTGAACTGCAGCCCCTAAATCTAAAGAAGAGTTACGAACCCTCGCA
GACACCTGAATCCGCACCCGTACCCGCATCTGTGATAAACGAATCGATTG
GATCGTGCTTTAGTACGTCTGGCTCGTTGAACAACAGCCTTAAGCCGGTG
GAGAAGATCGTGCTGAAGGAGAACACGCCCGGGCAGGATCTGCTGGAGTG
GTGCAAAGAAGTTACCAAAGACTACCCCAATGTTAAGGTTACCAACCTGA
CGACCAGCTGGCGCAACGGCATGGCCTTCTGCGCTATTATTCATCATTTT
GTGCCGGAGCTCATTGACATGTCTAAGCTGAGCGCCCATGACGTAGTTGG
CAATTGTCGAATTGGCTTCGATGCGGCGGAATCATTAGGAATACCTCGTG
TAATCGAGCCGCGCGACATGAATATGCTCACGGTACCGGACAAGTTGGCC
GTGATGACCTATTTGCATCAGTTGCGGGCGCACTTTACCGGCAAGCAGCT
AAAAATTGAGCAAATCGGTTCAACGGCAGACGAGTCGAGCTACGTTATTG
GAGACTACAAGTCGGACAATTTGTCGCAGAATCGCATTAACTTTTCGCAC
CCCAAGTCGTTGTTGCTGCATCAAAACTCATTCGATGAGGAGATAAATGG
TTCAAATAAATCGGAGCAACTTTCACCCACAAGCAAAAAGGATGTGAAGA
ATTTGATTCTGTACAACTCGAAGAATATTCTGGACAAGGTGCTGTCGCCC
ACCAAGGACAAGAACTCGATCAACGCATCGCAGCATGCAAATCAATCGCC
GATGTTGAGCTGCCAGACAACACCGCCGCAGGATGAATCACTGGATAAAG
GGTCACAACCGGGTGGCAAGGAGAACAGCTCCATAACCACCATTGATCCG
CAGGCGGCCAGTCGAATTTTAACGCGCCACAAGATGATGAGCGAAAAAGC
CAAGCTGATGATGGAAAAGCGAAAGCTTAACAAAACCAGCGACGCGAACG
ACGAGGAGAGGCAGCAGCGTCTGCTGGAACAGGCTCGTCGCCTTATCCTG
GAGACTCGTGTGAAGAGCGGTGGTTCCATCGAGAGTCCCACCAGGCCCAA
GCTGGAGCGCACCATCTCGCCGATCCACAACGGAGCCGAGGAATTCTATG
CGGAGCACGCGAAAAAGCTGGAGCTTAAGGAGCCAGGCAGTCCTAGTCAT
AGGTTAAGTGATCCGAAGGTCCTACAGTCCTTCAACGCAATCGTGGAGCG
CGTCTCACCAAAGCACGAGAAGAGGGGTGACAAGCTGTCCTACATCGATT
CCGAGCTGGAGGCCCTGGAGCGGGAGCAGGAGGCTATCGACCAGAAGGCC
AGCAATCTGGAGGCCAAGCTGCGCGCCGTAATGGGCGGCAATCCAAAGAC
CGAGGAGACAGAGGAGCAACTGCTATCGCAATGGTTTACGCTGGTCAACA
AGAAGAACGCACTCCTCCGGCGACAGATGCAGCTAAATATACTCGAGCAA
GAAAAAGATTTGGAGCGAAAATATACAATGCTTAATCAAGAGCTGCGGGC
GGCGCAATCTGTGGAAGATTGGCGCAAAACGGAAGTTCAGCGTGAAAAGG
AGCGACTGCTGCTCGAGGAACTGATGACGATTGTCGACAAGCGCGACCAG
TTGGTTCAGCACTTGCACAACCAAGAGATAGCGATCGAAGACGACCAGGA
GATCGCGAGGAAACTGGAGCACGTGGACATCAGTGCTGAAAAAGACAAAT
GTGTTCTTCAAGCAAGCTTTCTAGACCAT

BO27705.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Ehbp1-RG 2898 CG15609-PG 1..2895 17..2911 14475 100 Plus
Ehbp1-RB 2964 CG15609-PB 757..2961 707..2911 11025 100 Plus
Ehbp1-RI 2985 CG15609-PI 757..2982 707..2911 10780 99.1 Plus
Ehbp1-RB 2964 CG15609-PB 1..691 17..707 3455 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Ehbp1-RG 3829 CG15609-RG 383..3277 17..2911 14475 100 Plus
Ehbp1-RB 3864 CG15609-RB 1108..3312 707..2911 11025 100 Plus
Ehbp1-RI 4152 CG15609-RI 1143..3368 707..2911 10780 99.1 Plus
Ehbp1-RB 3864 CG15609-RB 352..1042 17..707 3455 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17011952..17012709 1464..707 3790 100 Minus
2R 25286936 2R 17011154..17011549 2062..1667 1980 100 Minus
2R 25286936 2R 17010262..17010535 2426..2153 1370 100 Minus
2R 25286936 2R 17013787..17013997 330..120 1055 100 Minus
2R 25286936 2R 17011612..17011816 1669..1465 1025 100 Minus
2R 25286936 2R 17013285..17013481 707..511 985 100 Minus
2R 25286936 2R 17008596..17008785 2833..2644 950 100 Minus
2R 25286936 2R 17013546..17013727 510..329 910 100 Minus
2R 25286936 2R 17010053..17010174 2546..2425 610 100 Minus
2R 25286936 2R 17014948..17015052 121..17 525 100 Minus
2R 25286936 2R 17008846..17008942 2643..2547 485 100 Minus
2R 25286936 2R 17010886..17010976 2153..2063 455 100 Minus
2R 25286936 2R 17008458..17008536 2911..2833 395 100 Minus
Blast to na_te.dros performed 2014-11-26 15:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
micropia 5461 micropia DMDM11 5461bp 339..375 854..890 122 81.1 Plus
micropia 5461 micropia DMDM11 5461bp 5324..5360 854..890 122 81.1 Plus

BO27705.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:22:59 Download gff for BO27705.complete
Subject Subject Range Query Range Percent Splice Strand
CG15609-RG 375..3269 17..2913 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:15 Download gff for BO27705.complete
Subject Subject Range Query Range Percent Splice Strand
Ehbp1-RG 383..3277 17..2913 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:01 Download gff for BO27705.complete
Subject Subject Range Query Range Percent Splice Strand
Ehbp1-RG 383..3277 17..2913 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:01 Download gff for BO27705.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17014949..17015052 17..120 100   Minus
2R 17013789..17013996 121..328 100 <- Minus
2R 17013546..17013727 329..510 100 <- Minus
2R 17013285..17013481 511..707 100 <- Minus
2R 17011952..17012708 708..1464 100 <- Minus
2R 17011614..17011816 1465..1667 100 <- Minus
2R 17011154..17011548 1668..2062 100 <- Minus
2R 17010887..17010976 2063..2152 100 <- Minus
2R 17010263..17010535 2153..2425 100 <- Minus
2R 17010053..17010173 2426..2546 100 <- Minus
2R 17008846..17008942 2547..2643 100 <- Minus
2R 17008597..17008785 2644..2832 100 <- Minus
2R 17008456..17008536 2833..2913 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:15 Download gff for BO27705.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12902454..12902557 17..120 100   Minus
arm_2R 12901294..12901501 121..328 100 <- Minus
arm_2R 12901051..12901232 329..510 100 <- Minus
arm_2R 12900790..12900986 511..707 100 <- Minus
arm_2R 12899457..12900213 708..1464 100 <- Minus
arm_2R 12899119..12899321 1465..1667 100 <- Minus
arm_2R 12898659..12899053 1668..2062 100 <- Minus
arm_2R 12898392..12898481 2063..2152 100 <- Minus
arm_2R 12897768..12898040 2153..2425 100 <- Minus
arm_2R 12897558..12897678 2426..2546 100 <- Minus
arm_2R 12896351..12896447 2547..2643 100 <- Minus
arm_2R 12896102..12896290 2644..2832 100 <- Minus
arm_2R 12895961..12896041 2833..2913 97 <- Minus

BO27705.pep Sequence

Translation from 16 to 2929

> BO27705.pep
MASVWKRLQRNFKRAAKFQFTASYHDLHLETTAKWRPSNLSIVWTRRSRR
VASAPLPWEPDMMNPLVGNISWPVPDNHTISVTLFKDPRTHELEDKDWTF
VIEDVTPMGKKRVLANASINMRKYASIESTQQSFTLSLKPVSKKITAASL
ELTISCVFLREGKATDEDMQSVVSMMSVNNNDVAPLDDLEDIPDLDGFSE
ITDNFNDFTQQLEHMTTSLNGCIDVATPQSDADGKREAANKLDLPTAASG
GSSGAEESLKTPNGLQHVVDQTPIKSPDEVKQPKQTPVESLRSKTNEDFD
KMVTSTPLEPNVNKDDVKPKKKRALFFTEKEDEQDLRVESVKEDTTKTIG
DNSTTKEKPKEESQSSKDASSVVVPSAKRPELQPLNLKKSYEPSQTPESA
PVPASVINESIGSCFSTSGSLNNSLKPVEKIVLKENTPGQDLLEWCKEVT
KDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIG
FDAAESLGIPRVIEPRDMNMLTVPDKLAVMTYLHQLRAHFTGKQLKIEQI
GSTADESSYVIGDYKSDNLSQNRINFSHPKSLLLHQNSFDEEINGSNKSE
QLSPTSKKDVKNLILYNSKNILDKVLSPTKDKNSINASQHANQSPMLSCQ
TTPPQDESLDKGSQPGGKENSSITTIDPQAASRILTRHKMMSEKAKLMME
KRKLNKTSDANDEERQQRLLEQARRLILETRVKSGGSIESPTRPKLERTI
SPIHNGAEEFYAEHAKKLELKEPGSPSHRLSDPKVLQSFNAIVERVSPKH
EKRGDKLSYIDSELEALEREQEAIDQKASNLEAKLRAVMGGNPKTEETEE
QLLSQWFTLVNKKNALLRRQMQLNILEQEKDLERKYTMLNQELRAAQSVE
DWRKTEVQREKERLLLEELMTIVDKRDQLVQHLHNQEIAIEDDQEIARKL
EHVDISAEKDKCVLQASFLDH

BO27705.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
Ehbp1-PG 965 CG15609-PG 1..965 1..965 4942 100 Plus
Ehbp1-PB 987 CG15609-PB 1..987 1..965 4909 97.8 Plus
Ehbp1-PI 994 CG15609-PI 1..994 1..965 4891 97.1 Plus
Ehbp1-PF 1141 CG15609-PF 1..835 1..843 4108 94 Plus
Ehbp1-PF 1141 CG15609-PF 991..1141 816..965 608 83.4 Plus
MICAL-like-PA 1010 CG11259-PA 8..448 434..881 278 25.6 Plus