Clone BO27707 Report

Search the DGRC for BO27707

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:7
Vector:pDNR-Dual
Associated Gene/TranscriptCG14277-RA
Protein status:BO27707.pep: Imported from assembly
Sequenced Size:541

Clone Sequence Records

BO27707.complete Sequence

541 bp assembled on 2010-08-18

GenBank Submission: KX798676

> BO27707.complete
GAAGTTATCAGTCGACATGTTGCGTCTGATTTGCGTGTTCCTGCTCAGCT
GCGTTGGCTTCCAGGCAGCCTTGGCTTGCAATGGCTACAAAGCCAAGCTG
GTCAAGTTGGAGAACTGTGCCGGCGAGGATGCCATTATGACGGTGGGCAG
TGACTTCAGCCTGAAGCTAAACAAGAAGTGTGAACTGGTACCCTCGGGCT
GCATCATGAACAAGCCGTTCAGTACCGCGGTGGCTAAGTTCAAGGTCCAG
AAGGATGGCATCGTAATGAAGGAGGGCAAGATCGATCTATGCGCCGCCAT
TGATCAGGCCTCCTCCGAAGGTAAGGACATGCTAAAGCTTTTCGGAGCAC
CTTCCTCCTGTCCGGTGGGCGAGGAGAAGGTGTGCGCCAACGATCACTCC
GTGGATCTGAGCAAGTACAAGGCCATGTTGGGCATGGCTCGTGGTCACCT
CATCATCGATTCTGAGGTCAAGCATGACACGGGCAAGTCCTGCATTCATG
CCGAAATCGAGATCACCAAGAACGCAAGCTTTCTAGACCAT

BO27707.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14277-RB 510 CG14277-PB 1..507 17..523 2535 100 Plus
CG14277-RA 510 CG14277-PA 1..507 17..523 2535 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14277-RB 825 CG14277-RB 182..688 17..523 2535 100 Plus
CG14277-RA 679 CG14277-RA 36..542 17..523 2535 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8242783..8243185 80..482 2015 100 Plus
2L 23513712 2L 8242667..8242729 17..79 315 100 Plus
2L 23513712 2L 8243247..8243289 481..523 215 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:37:12 has no hits.

BO27707.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:53 Download gff for BO27707.complete
Subject Subject Range Query Range Percent Splice Strand
CG14277-RA 6..507 22..525 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:18:13 Download gff for BO27707.complete
Subject Subject Range Query Range Percent Splice Strand
CG14277-RA 41..542 22..525 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:15:07 Download gff for BO27707.complete
Subject Subject Range Query Range Percent Splice Strand
CG14277-RA 41..542 22..525 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:15:07 Download gff for BO27707.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8243248..8243289 482..525 95   Plus
2L 8242783..8243184 80..481 100 -> Plus
2L 8242672..8242729 22..79 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:18:13 Download gff for BO27707.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8243248..8243289 482..525 95   Plus
arm_2L 8242783..8243184 80..481 100 -> Plus
arm_2L 8242672..8242729 22..79 100 -> Plus

BO27707.pep Sequence

Translation from 16 to 541

> BO27707.pep
MLRLICVFLLSCVGFQAALACNGYKAKLVKLENCAGEDAIMTVGSDFSLK
LNKKCELVPSGCIMNKPFSTAVAKFKVQKDGIVMKEGKIDLCAAIDQASS
EGKDMLKLFGAPSSCPVGEEKVCANDHSVDLSKYKAMLGMARGHLIIDSE
VKHDTGKSCIHAEIEITKNASFLDH

BO27707.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG14277-PB 169 CG14277-PB 1..169 1..169 876 100 Plus
CG14277-PA 169 CG14277-PA 1..169 1..169 876 100 Plus