Clone BO27725 Report

Search the DGRC for BO27725

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptPfk-RC
Protein status:BO27725.pep: Imported from assembly
Sequenced Size:2398

Clone Sequence Records

BO27725.complete Sequence

2398 bp assembled on 2010-10-15

GenBank Submission: KX800078

> BO27725.complete
GAAGTTATCAGTCGACATGAATTCCGAGATTAATCAACGATTCCTGGCCC
GCGGCTCGCAGAAGGACAAAGGACTGGCGGTCTTCACCAGCGGCGGGGAT
TCCCAGGGCATGAATGCCGCCGTGCGAGCCTGTGTCCGTATGGCCATCTA
TTTGGGCTGCAAGGTCTACTTCATTCGTGAAGGCTACCAGGGCATGGTGG
ATGGTGGCGACTGCATCCAGGAAGCCAACTGGGCCTCAGTCTCATCCATT
ATCCATCGTGGTGGCACCATCATTGGCTCCGCCCGTTGCCAGGACTTCCG
TGAGCGTCAGGGTCGCTTGAAAGCCGCTAACAACCTGATTCAGCGAGGAA
TCACCAATCTGGTGGTCATTGGAGGCGATGGCTCCCTCACGGGCGCCAAT
CTGTTCCGTCAGGAGTGGTCCAGCCTGTTGGACGAGCTGGTCAAGAACAA
GACCATTACCACCGAGCAGCAGGAGAAGTTCAATGTCCTGCACATCGTTG
GATTGGTTGGCTCCATCGACAACGATTTCTGTGGCACTGACATGACCATC
GGCACGGACACGGCACTACATCGCATCATCGAGGCAATCGATGCCATCTC
CAGTACAGCCTACTCCCATCAGCGCACCTTCATCATGGAGGTCATGGGTC
GTCATTGCGGTTACTTAGCCATATCGGCAGCCATAGCCACAGAGGCTGAT
TTTATGTTCATACCCGAGGAGCCGGTGTCAGTCAATTGGAAGGACGAGAT
CTGTGTCAAGCTCCACCAGGAGCGATCTGCTGGCCAGCGTCTGAACATCG
TGATTGTGGCCGAGGGAGCCATGGATCGCGAGGGTCATCCCATCACAGCC
GAGGATGTAAAGAAGGTGATCGACGAGCGTCTGAAGCACGATGCCCGCAT
CACTGTCTTGGGTCACGTGCAGCGCGGTGGCAATCCCAGTGCCTTCGATC
GTATTTTGGCTTGCCGCATGGGAGCTGAGGCCACTTTGGCCCTGATGGAG
GCCACCAAGGACTCGGTGCCAGTGGTCATCTCTCTGGACGGCAACCAGGC
GGTTCGCGTGCCGCTGATGGAGTGCGTAGAGCGCACCCAGGCTGTGGCCA
AGGCCATGGCGGAGAAACGCTGGGCGGATGCCGTCAAGCTGCGCGGACGC
TCCTTCGAGCGGAATCTGGAGACCTACAAGATGCTGACGCGCTTGAAGCC
GCCCAAGGAGAACTTCGACGCCGATGGCAAGGGAATCGAAGGATACCGCC
TAGCTGTGATGCATATTGGTGCTCCGGCTTGCGGTATGAATGCCGCTGTG
CGCAGCTTCGTGCGCAATGCCATCTACCGCGGTGATGTGGTTTATGGAAT
CAACGACGGTGTCGAGGGTCTGATTGCCGGAAATGTCCGCGAGCTGGGCT
GGTCGGATGTCTCAGGATGGGTTGGTCAGGGTGGCGCCTACTTGGGTACC
AAACGCACACTGCCTGAGGGCAAGTTCAAGGAGATCGCCGCTCGTCTCAA
GGAGTTTAAGATCCAGGGTCTCCTGATCATTGGTGGCTTTGAGAGTTACC
ATGCCGCCGGACAGATCGCCGATCAGCGGGACAACTACCCACAGTTCTGC
ATCCCCATTGTGGTTATTCCATCGACGATTTCGAACAATGTGCCCGGCAC
AGAATTTTCTCTGGGATGCGACACCGGTTTAAATGAGATTACGGAGATTT
GCGACCGTATCCGTCAGTCGGCACAGGGAACCAAGCGCCGAGTGTTCGTC
ATTGAGACGATGGGTGGCTACTGTGGCTATTTGGCCACCTTGGCCGGCTT
GGCCGGCGGAGCTGATGCCGCCTACATCTACGAGGAGAAGTTCTCCATCA
AAGACCTGCAGCAGGATGTCTACCACATGGCCTCCAAGATGGCCGAGGGC
GTCTCCCGCGGTCTAATCCTGCGAAACGAGAAGGCTAGCGAGAACTACAG
CACGGACTTCATTTACCGCCTGTACTCGGAGGAGGGCAAGGGCCTCTTCA
CCTGCCGTATGAACATCCTGGGTCACATGCAGCAGGGCGGCTCACCCACT
CCCTTCGACCGCAACATGGGCACCAAAATGGCCGCCAAGTGTGTCGACTG
GCTGGCCGCCCAGATCAAGGCGAACATCGACGCCAACGGCGTAGTCAACT
GCAAGTCCCCGGACACCGCCACGCTGCTGGGAATCGTGTCGCGGCAGTAC
CGCTTCTCACCGCTGGTCGACCTCATTGCAGAGACGAACTTCGATCAACG
CATCCCGAAGAAGCAGTGGTGGCTGCGCCTGCGTCCCCTGCTGCGCATCC
TGGCCAAGCACGATTCCGCCTACGAGGAGGAGGGTATGTACATCACCGTC
GAGGAGGAGTGTGACACTGACGCCGTCGCCGCAAGCTTTCTAGACCAT

BO27725.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Pfk-RC 2367 CG4001-PC 1..2364 17..2380 11820 100 Plus
Pfk-RB 2367 CG4001-PB 1..2364 17..2380 11145 98.1 Plus
Pfk-RA 2853 CG4001-PA 532..2850 62..2380 10920 98.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Pfk-RC 3188 CG4001-RC 560..2923 17..2380 11820 100 Plus
Pfk-RB 3508 CG4001-RB 560..2923 17..2380 11145 98.1 Plus
Pfk-RA 3217 CG4001-RA 634..2952 62..2380 10920 98.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10115814..10116657 1401..2244 4220 100 Plus
2R 25286936 2R 10115314..10115759 958..1403 2230 100 Plus
2R 25286936 2R 10112612..10112960 159..507 1745 100 Plus
2R 25286936 2R 10114910..10115106 763..959 970 99.5 Plus
2R 25286936 2R 10113015..10113170 505..660 780 100 Plus
2R 25286936 2R 10111429..10111577 17..165 745 100 Plus
2R 25286936 2R 10116737..10116872 2245..2380 680 100 Plus
2R 25286936 2R 10114125..10114235 660..770 555 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:03:46 has no hits.

BO27725.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:05 Download gff for BO27725.complete
Subject Subject Range Query Range Percent Splice Strand
Pfk-RC 533..2896 17..2382 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:32 Download gff for BO27725.complete
Subject Subject Range Query Range Percent Splice Strand
Pfk-RC 560..2923 17..2382 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:41 Download gff for BO27725.complete
Subject Subject Range Query Range Percent Splice Strand
Pfk-RC 560..2923 17..2382 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:41 Download gff for BO27725.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10116737..10116872 2245..2382 98   Plus
2R 10115815..10116657 1402..2244 100 -> Plus
2R 10115315..10115757 959..1401 100 -> Plus
2R 10114917..10115105 770..958 100 -> Plus
2R 10114126..10114234 661..769 100 -> Plus
2R 10113016..10113170 506..660 100 -> Plus
2R 10112617..10112958 164..505 100 -> Plus
2R 10111429..10111575 17..163 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:32 Download gff for BO27725.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6004242..6004377 2245..2382 98   Plus
arm_2R 6003320..6004162 1402..2244 100 -> Plus
arm_2R 6002820..6003262 959..1401 100 -> Plus
arm_2R 6002422..6002610 770..958 100 -> Plus
arm_2R 6001631..6001739 661..769 100 -> Plus
arm_2R 6000521..6000675 506..660 100 -> Plus
arm_2R 6000122..6000463 164..505 100 -> Plus
arm_2R 5998934..5999080 17..163 100 -> Plus

BO27725.pep Sequence

Translation from 16 to 2398

> BO27725.pep
MNSEINQRFLARGSQKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKV
YFIREGYQGMVDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERQGR
LKAANNLIQRGITNLVVIGGDGSLTGANLFRQEWSSLLDELVKNKTITTE
QQEKFNVLHIVGLVGSIDNDFCGTDMTIGTDTALHRIIEAIDAISSTAYS
HQRTFIMEVMGRHCGYLAISAAIATEADFMFIPEEPVSVNWKDEICVKLH
QERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGH
VQRGGNPSAFDRILACRMGAEATLALMEATKDSVPVVISLDGNQAVRVPL
MECVERTQAVAKAMAEKRWADAVKLRGRSFERNLETYKMLTRLKPPKENF
DADGKGIEGYRLAVMHIGAPACGMNAAVRSFVRNAIYRGDVVYGINDGVE
GLIAGNVRELGWSDVSGWVGQGGAYLGTKRTLPEGKFKEIAARLKEFKIQ
GLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISNNVPGTEFSLG
CDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGAD
AAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYSTDFIY
RLYSEEGKGLFTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLAAQI
KANIDANGVVNCKSPDTATLLGIVSRQYRFSPLVDLIAETNFDQRIPKKQ
WWLRLRPLLRILAKHDSAYEEEGMYITVEEECDTDAVAASFLDH

BO27725.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Pfk-PC 788 CG4001-PC 1..788 1..788 4086 100 Plus
Pfk-PB 788 CG4001-PB 1..788 1..788 4003 97.8 Plus
Pfk-PA 950 CG4001-PA 178..950 16..788 3929 97.8 Plus
Pfk-PD 950 CG4001-PD 178..950 16..788 3922 97.4 Plus
Pfk-PE 922 CG4001-PE 184..922 50..788 3746 97.3 Plus