Clone BO27739 Report

Search the DGRC for BO27739

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptRm62-RE
Protein status:BO27739.pep: Imported from assembly
Sequenced Size:1768

Clone Sequence Records

BO27739.complete Sequence

1768 bp assembled on 2010-10-15

GenBank Submission: KX799894

> BO27739.complete
GAAGTTATCAGTCGACATGCGAGCAAAGGCACCACACGATCGCGACTTTG
GTCACAGTGGACGTGGCGGTCGCGGAGGCGATCGAGGCGGCGATGATCGG
CGAGGAGGCGGCGGCGGAGGCAATCGCTTCGGTGGCGGCGGTGGCGGTGG
CGATTACCACGGCATAAGGAATGGACGCGTCGAGAAGCGACGCGATGACC
GCGGAGGCGGCAACCGATTTGGAGGTGGTGGTGGATTCGGGGATCGCCGA
GGAGGAGGTGGCGGCGGCAGCCAAGACCTCCCCATGCGTCCGGTCGACTT
CTCCAACCTGGCTCCCTTCAAGAAGAACTTTTACCAGGAGCACCCTAACG
TAGCAAACCGATCGCCCTACGAAGTTCAGAGGTATCGCGAAGAGCAGGAG
ATCACCGTGCGCGGACAGGTGCCGAACCCCATCCAGGACTTCTCCGAGGT
CCATCTGCCCGACTACGTCATGAAGGAGATCCGCCGACAGGGCTACAAGG
CCCCCACCGCTATCCAAGCGCAGGGCTGGCCTATCGCCATGAGTGGCTCG
AACTTCGTCGGCATTGCCAAGACGGGATCCGGAAAGACCCTGGGCTACAT
CCTGCCCGCTATTGTCCACATCAACAACCAGCAGCCGCTGCAGAGGGGCG
ACGGACCTATCGCCCTCGTGCTGGCCCCCACTCGGGAGCTGGCCCAACAG
ATCCAGCAGGTGGCCACCGAATTCGGTTCCTCGTCGTATGTTCGCAACAC
CTGCGTCTTCGGCGGCGCCCCGAAGGGCGGCCAAATGCGGGATCTGCAGC
GCGGCTGCGAGATCGTCATTGCCACACCCGGACGTCTTATTGATTTCCTC
TCCGCCGGCTCTACTAACCTGAAGCGTTGCACCTACTTGGTGCTGGACGA
GGCCGATCGCATGTTAGACATGGGCTTCGAGCCCCAGATCAGAAAGATCG
TCTCACAGATCCGGCCCGACCGACAGACGCTCATGTGGAGCGCTACCTGG
CCCAAGGAGGTCAAGCAGCTTGCCGAGGACTTTTTGGGCAACTACATCCA
GATCAACATTGGATCGCTGGAGCTGTCCGCCAATCACAACATCCGCCAGG
TGGTGGACGTTTGTGACGAGTTCAGCAAGGAGGAGAAATTGAAGACCCTC
CTGTCAGACATCTACGACACCAGCGAGAGCCCCGGCAAGATTATCATATT
CGTGGAGACAAAGCGACGCGTGGACAACCTGGTGCGCTTCATCCGCAGCT
TCGGAGTCCGTTGTGGAGCTATTCACGGTGACAAGTCGCAATCAGAACGA
GACTTTGTGCTCCGTGAGTTCCGCTCGGGCAAGTCCAACATTCTGGTGGC
CACCGATGTGGCGGCCCGTGGACTAGACGTGGACGGCATCAAGTATGTCA
TCAACTTTGACTACCCGCAAAACAGCGAGGACTACATCCATCGCATCGGT
CGCACAGGACGATCCAACACAAAGGGCACCTCTTTCGCCTTCTTCACCAA
GAACAATGCCAAGCAAGCCAAGGCGCTGGTCGACGTACTCCGAGAAGCTA
ATCAGGAAATCAATCCTGCCCTGGAAAATCTGGCCCGCAACTCGCGCTAC
GACGGTGGCGGCGGACGCTCCCGTTATGGAGGCGGTGGCGGCGGCGGTCG
CTTCGGCGGCGGCGGCTTCAAGAAGGGCAGCCTGAGCAACGGACGAGGCT
TCGGAGGAGGCGGCGGCGGCGGCGGCGAAGGCAGACACTCGCGCTTCGAC
GCAAGCTTTCTAGACCAT

BO27739.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
Rm62-RI 1737 CG10279-PI 1..1734 17..1750 8670 100 Plus
Rm62-RE 1737 CG10279-PE 1..1734 17..1750 8670 100 Plus
Rm62-RA 2160 CG10279-PA 428..2157 21..1750 8620 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
Rm62-RI 3153 CG10279-RI 679..2413 16..1750 8675 100 Plus
Rm62-RE 3160 CG10279-RE 691..2425 16..1750 8675 100 Plus
Rm62-RH 2760 CG10279-RH 296..2025 21..1750 8620 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6004017..6005126 1137..28 5550 100 Minus
3R 32079331 3R 6003673..6003911 1376..1138 1195 100 Minus
3R 32079331 3R 6001166..6001365 1750..1551 1000 100 Minus
3R 32079331 3R 6001557..6001739 1556..1374 915 100 Minus
X 23542271 X 7928923..7929222 1099..800 420 76 Minus
X 23542271 X 7929323..7929525 705..503 295 76.4 Minus
Blast to na_te.dros performed on 2014-11-26 15:04:09 has no hits.

BO27739.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:06 Download gff for BO27739.complete
Subject Subject Range Query Range Percent Splice Strand
Rm62-RE 425..2158 17..1752 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:33 Download gff for BO27739.complete
Subject Subject Range Query Range Percent Splice Strand
Rm62-RE 692..2425 17..1752 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:51 Download gff for BO27739.complete
Subject Subject Range Query Range Percent Splice Strand
Rm62-RE 692..2425 17..1752 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:51 Download gff for BO27739.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6004017..6005126 28..1137 100   Minus
3R 6003673..6003911 1138..1376 100 <- Minus
3R 6001558..6001736 1377..1555 100 <- Minus
3R 6001164..6001360 1556..1752 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:33 Download gff for BO27739.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1829739..1830848 28..1137 100   Minus
arm_3R 1829395..1829633 1138..1376 100 <- Minus
arm_3R 1827280..1827458 1377..1555 100 <- Minus
arm_3R 1826886..1827082 1556..1752 98 <- Minus

BO27739.pep Sequence

Translation from 16 to 1768

> BO27739.pep
MRAKAPHDRDFGHSGRGGRGGDRGGDDRRGGGGGGNRFGGGGGGGDYHGI
RNGRVEKRRDDRGGGNRFGGGGGFGDRRGGGGGGSQDLPMRPVDFSNLAP
FKKNFYQEHPNVANRSPYEVQRYREEQEITVRGQVPNPIQDFSEVHLPDY
VMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIV
HINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGG
APKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRML
DMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGS
LELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKR
RVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAA
RGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQ
AKALVDVLREANQEINPALENLARNSRYDGGGGRSRYGGGGGGGRFGGGG
FKKGSLSNGRGFGGGGGGGGEGRHSRFDASFLDH

BO27739.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
Rm62-PI 578 CG10279-PI 1..578 1..578 3060 100 Plus
Rm62-PE 578 CG10279-PE 1..578 1..578 3060 100 Plus
Rm62-PF 578 CG10279-PF 1..578 1..578 3043 99.5 Plus
Rm62-PB 578 CG10279-PB 1..578 1..578 3043 99.5 Plus
Rm62-PC 578 CG10279-PC 1..578 1..578 3043 99.5 Plus