Clone BO27751 Report

Search the DGRC for BO27751

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:51
Vector:pDNR-Dual
Associated Gene/TranscriptDhap-at-RA
Protein status:BO27751.pep: Imported from assembly
Sequenced Size:2206

Clone Sequence Records

BO27751.complete Sequence

2206 bp assembled on 2010-09-13

GenBank Submission: KX799359

> BO27751.complete
GAAGTTATCAGTCGACATGGATAGAAATCCCGTGAGGCAGTCGACGTCAT
CCGGCACCGTAGAAGGTGAATCCAGCGAACAGGAGGAGCAGAAGACGCCC
AGTGCGGCCGAATATATGAGGAACTTCAAGAACATCATAGCGCCGGGCAA
CGAGGCCTCCATGACCAGGGAGTTCAATCCGCAGGTGGCATACGAATTCG
AAAAGTATCTCAATCCGCAAAAGCTCAAGCAGCACGTCCTTAGGAGCGAG
AAGCTGCGATCCATTCTGGAGCACTATGCCAAGGAGTCGGGCACGCCGCT
CAAGCAGATGGAGCGTCAGGCCCGGGCGATCATTGATGAAATCGGCCTCG
ATCGGAATATGGCCATCATCCGGTGGTGCGGCATTGCCATTACGGCGATC
GGCAAGCGGATCTGCGATGGATTCTATGTCAATTCGGCTAGCATGGCCAA
TGTGCGCAAGGATATGGGCAAGTGCCCGGTGCTCTATCTGCCAAGTCATC
GCAGCTACATGGACTTCATCCTGATGTCCTACATCTGCTATTACTACGAC
ATCGAGATACCAGGAATAGCAGCCGGCATGGATTTCCACTCCATGTTCGG
AATGGGCACCATGTTGAGGAAAACAGGAGCGTTCTTCATGCGCCGCAGCT
TCTCCAACGATGAGCTATACTGGGATATTTTCCGGGAGTATATGTACGCG
CTGGTGGCAAACTACCACATCGGCGTGGAGTTCTTCATTGAGGGCACGCG
CTCCAGGAATTTCAAAGCTCTGGTTCCCAAAATTGGACTACTCTCGATGG
CTCTGTTGCCATATTTCACGGGCGAAGTGCCGGATGTGATGATTGTGCCA
GTGAGTGTGGCCTACGAACGCGTCCTGGAGGAGCAACTGTTCGTCTATGA
GCTGCTGGGTGTGCCCAAGCCCAAGGAGTCGACAAAGGGCTTTTTCAAGG
CCCTAAAAATCATCGACGAGCGATTTGGCAAGATGTTCCTCGACTTCGGA
GAGCCCATCTCGGTCAAGGAGTTTTTCGGACACGACAGCGCGCAGCGAAT
GCAGCGAGCAGGCGTGGGTGGTCACTTGCAGAAGCTGAACCGCCAGGAGG
TGGAACTAGTCAAACAGCTGGCCAATGAGATTATCTACCAGCAGCAGCGT
CGCATTGTGATCTCCACGTTCAATCTGCTTAGCCTCTACTACGCCAGTCA
ATTGTATGCCCAAAGGAGTGTCACTCTGGACGAGCTAGCACGAGGTGTTC
TGCATCTGAAGCGAATCTTCGAGCAGCTGGGCGCCCATGTTAGCACGACT
CCGAGCAGCATTAAGGCGGATGTGATTGATGCTGTGGAGATACACTCGAA
TATTTTACATTTCGCGACTGGCCGCCTGCAGTTTACGCCCATGGCAGCCA
AGCAACTGGCGGAGCAGATCGATGTTAAGCGCCTGAAAGCCCATGCCCTG
TGTCCACAGACCATGGCGGTGGCTGTGCCCATGCTGGCACTGCAGCTCTA
CATTAATCCCTGCATGTTCTGGCTGGCCAGACCCGCCTACCTGCTGCTGG
CAGCGCTCAAGGAGCAAAAGAATCAACAGAAGCAATCGACGGACATCTCG
TACGATGCCAGTTTGTGTGCCCTGCATGCGCACGTGACCACCATGGACGC
GCTATTCCAGCACGAGTTCATCATTGAATCGAATCGCGAGGCGGCCGAGT
TTGAGACGCATCTGCAGCTGCTGCTGGACGAACGAGTTGTGGAGGTAGAG
ACCAGTGGCCGGATCAATGTGCAGGACAATGAATGCTCGCATGTCATTCT
GGCCGCCCTGGCGCCATTCCTCTGCCTCTACTACCAACTGGTGGTCACGT
TAAGAAAGATCCCTTTGGAGCTGGAGTTCAGTAACAAGGAGCTGCTCGTG
CGCGTCCAGCAGCATGTGGAGCAGCTCCTACAGCAACCCGGAGCCTCCGC
CTCTCATGTGCACCCATATTGCCTGGCCCTGGACAATCTGAACATTGCCA
TCTATGCGCTAATCCAGAGGGGCTACCTAGTGAAGAGCAGGGACTCTGGT
CAGATGAAGATCGCGTCCACTCCGGGAAAGTGCCTGCGAGAACTGGAAAC
GCAGCTTCTCGAGTACTGTCAACTAATGCCATTTGCTCAATACTCGACGG
CGGCCAACCAGCAGGCCCAGTTCCACATAGCCAAGTTAGCAAGCTTTCTA
GACCAT

BO27751.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dhap-at-RC 2424 CG4625-PC 1..2172 17..2188 10860 100 Plus
Dhap-at-RB 2175 CG4625-PB 1..2172 17..2188 10860 100 Plus
Dhap-at-RA 2175 CG4625-PA 1..2172 17..2188 10860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dhap-at-RC 3516 CG4625-RC 356..2527 17..2188 10860 100 Plus
Dhap-at-RB 3441 CG4625-RB 281..2452 17..2188 10860 100 Plus
Dhap-at-RA 3516 CG4625-RA 356..2527 17..2188 10860 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25486995..25488272 1858..581 6390 100 Minus
3R 32079331 3R 25488524..25489088 581..17 2825 100 Minus
3R 32079331 3R 25486607..25486938 2188..1857 1660 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:23:27 has no hits.

BO27751.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:32 Download gff for BO27751.complete
Subject Subject Range Query Range Percent Splice Strand
Dhap-at-RA 1..2172 17..2190 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:57 Download gff for BO27751.complete
Subject Subject Range Query Range Percent Splice Strand
Dhap-at-RA 356..2527 17..2190 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:17:02 Download gff for BO27751.complete
Subject Subject Range Query Range Percent Splice Strand
Dhap-at-RA 356..2527 17..2190 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:17:02 Download gff for BO27751.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25488524..25489088 17..581 100   Minus
3R 25486995..25488271 582..1858 100 <- Minus
3R 25486605..25486936 1859..2190 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:57 Download gff for BO27751.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21314246..21314810 17..581 100   Minus
arm_3R 21312717..21313993 582..1858 100 <- Minus
arm_3R 21312327..21312658 1859..2190 99 <- Minus

BO27751.pep Sequence

Translation from 16 to 2206

> BO27751.pep
MDRNPVRQSTSSGTVEGESSEQEEQKTPSAAEYMRNFKNIIAPGNEASMT
REFNPQVAYEFEKYLNPQKLKQHVLRSEKLRSILEHYAKESGTPLKQMER
QARAIIDEIGLDRNMAIIRWCGIAITAIGKRICDGFYVNSASMANVRKDM
GKCPVLYLPSHRSYMDFILMSYICYYYDIEIPGIAAGMDFHSMFGMGTML
RKTGAFFMRRSFSNDELYWDIFREYMYALVANYHIGVEFFIEGTRSRNFK
ALVPKIGLLSMALLPYFTGEVPDVMIVPVSVAYERVLEEQLFVYELLGVP
KPKESTKGFFKALKIIDERFGKMFLDFGEPISVKEFFGHDSAQRMQRAGV
GGHLQKLNRQEVELVKQLANEIIYQQQRRIVISTFNLLSLYYASQLYAQR
SVTLDELARGVLHLKRIFEQLGAHVSTTPSSIKADVIDAVEIHSNILHFA
TGRLQFTPMAAKQLAEQIDVKRLKAHALCPQTMAVAVPMLALQLYINPCM
FWLARPAYLLLAALKEQKNQQKQSTDISYDASLCALHAHVTTMDALFQHE
FIIESNREAAEFETHLQLLLDERVVEVETSGRINVQDNECSHVILAALAP
FLCLYYQLVVTLRKIPLELEFSNKELLVRVQQHVEQLLQQPGASASHVHP
YCLALDNLNIAIYALIQRGYLVKSRDSGQMKIASTPGKCLRELETQLLEY
CQLMPFAQYSTAANQQAQFHIAKLASFLDH

BO27751.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dhap-at-PC 807 CG4625-PC 1..724 1..724 3708 100 Plus
Dhap-at-PB 724 CG4625-PB 1..724 1..724 3708 100 Plus
Dhap-at-PA 724 CG4625-PA 1..724 1..724 3708 100 Plus
mino-PB 757 CG5508-PB 101..404 95..412 297 27.6 Plus
mino-PC 786 CG5508-PC 130..433 95..412 297 27.6 Plus