Clone BO27752 Report

Search the DGRC for BO27752

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG30377-RA
Protein status:BO27752.pep: Imported from assembly
Sequenced Size:2725

Clone Sequence Records

BO27752.complete Sequence

2725 bp assembled on 2010-10-15

GenBank Submission: KX796362

> BO27752.complete
GAAGTTATCAGTCGACATGCCCATTTGCAAAAGTTCACCGGGTACGGCGA
GCAACAAAACAGCCACGGATATATCCGCCGACCACGTGACGGAAGCGGCC
CAGGTGAAGCGGACGCGGGAGCAGGCCTACTTCAACTCCTACGACTTCGA
TGCAATCGAGGTGCTGCCCTACGAGGAGGAGGACGACGAGGCGGGAGGCA
CCAGTCACAGCAGGAGCAGGAGCAGGAGCCAGAGCCGTAGCCAAAGTCGT
TGCGGAAGCAGCAGCAGCCGGAGCAGCAGCACCAGGAGCTACTCCGCAGC
CAAGGAGCCCGTTGCCGGCCACAAGTTTGCCTATCTGCAACGCCTGGGCG
CCTTTTTTGCTCGCAACGGAGGTGGAGCAGGCGAATCGGGATCGGGAGAA
GCTGCTGGTATAGCTGCTCCAAGTGGAGGAGGTGCATCCAACGCGGCGCC
CAAGGGAAGCAGCGAAAATTTTCTACTGCCACGAGCCATGCTTAAATATC
AAAGCACGGCGACAGCATCAGCCTCGCCATCGTCCACATCCACGGCAGCG
GTTGCAATGCCACTGAAGAATGGACTGGCCAATGGAATGGGGAATGCAAT
TGGTCACGACCAACAGCTGGAGGCGACCGGCAGCGCGGGGGAGCGCAGCA
AGAAGTGCTCGATTGCGTCCAATGTCAGCAGCACGCATTCCACGGATTCC
GGACTGCCAGTCGCAGCAGCAGCAGTATCAGCATCAGCATCAGCTTCAGC
GGCAGCATCTGCGACTGCAGCAACATCTGCTGCAGCAGCGGCAGCAGCAG
CACAGGCGGCGCGTGGCGGAGGAGGTGATGGTGGCGGCTCACACTATTCG
ACGGACAAAAGCGGCTCGTCCGGTTATTACAGCTCCAATGTGTGCTCCAC
TTACTCGCTGGACGAGCACATCTATTGCGAACCAGTCATCGATGTCCAGG
AGAAGATCAAGAGTGTGGCCGCCAGACAGCGGCAAAGACCACCGCTCCAG
CTACCAACGAAAGTGGGCGCTCCGCAGGAGGCGCCATCGATAGACCCACC
GGAAGGCTCATCGGAAAAGTTGTCCGCAGTGAAGAGTCAGCGCTCGGACA
TGCAAGATGCAGCCGGAGCTGCCGCATCGAATAGCCATCAAACGCAGTCG
AAGGCCGAGGCGGCCGAGGGGCTGCATCACTACAGCAAAAAGCTGCGAGT
TCTGGAGACGAGCATCGAGAATCTGGACCGCCACCTGAAGACTTTTCCCA
GTCTGTATGCCCAAGAGCATATTGTGAGCTTCATGCAAGTGGCCGGCGCA
AGAAACGAAGGCCCACCCCAGGCTCTGGATATTGGAGAGAAGCTAAGGGT
CTACAACCAGTTGCCCACCATCATGGAGCAGCAGCAGCAGCAGCAACAGG
AGCAGATGGTGGATGATTCATTGCTGGATATTGACCTAGATGCCTTTCTT
TTGGCGCCCAACGCGGGGCATCGTGGCATCGACAATCCCAGCTTTCTGAA
CGACGAGCAGCTGGCGGAGAACAACTACAAGTGCGCCAAGTACATCAACT
CCTGTCCCGAAGATGCCTACCGCCTGGAGAGCGAAAGGGGCGGAGCGGGA
GGACCTGGTGTGGGCGTGGCAGAGGAGACATATGTCAAGCGGTATGAGGA
TCAGTTGCACTTCCAGAACACGCGGGAGCTGTTGGAGGACGTCCGTGATA
AGATCCGCCTCCTATCGCGTGCCACACCCCCGACTTCGGGCACGCCCACA
CCCGCCAGCACCCCGCCCTCCGATGTGCCCAAGGAACTGGAAGGGATGAT
CCACACGCTGAAGCACGAACTAGAGTCGTACCTGCAGCGCATGAACCAGC
ACAGTGAGCTGGAACTCCGGCAGTTGTGCAGCGGCTTGGGACGCCAGCAG
CACGTGGTCCGCATGCAAAACGCCCTGGAACGCAGACGCAGTTGCGCCGA
TCTTCAACTGAATGCCTACGAGGCAGTACGGGATGGAGTACTCATCTCCG
CCAATGGCCGACCTCTCAGCGTTCGCGAGCAGATCATGACCATTCGTTGT
GCCAGCGATCCCAACTTCAAGATGAAGCGCAAGTCCATAGCGGAGATCTT
TCCCGCCGCCGAATGCTATGTGGAATCGGAGGTCACCACCACCAGTCTCT
CGCGCAGTGCCACGCCCTCGCCCGCCTCAACGCCGCAGTTGGAGCTCGAG
GCATTGCATCCAGGCCTAGCTACGACCACAATAGTTACGCAAATGCAGCG
CAACCTCACCTTCCACAAGCCCATTCTCGCGGTGTCCAACAGCAATCCTG
GAGGTGGAAATGTGACGGTGGACGGAGCTGGCGGCAATAAGGCCGAGCGG
GATCGGGAGCGGGAAAGCCTCGCCGAGTGGCACCGCAAGAAGCCCAGCAT
CTGGGAGATGTACTACGGCACCAATCGGCTCCATCAGTCGCTCCTCGGGA
AGCAGCGAGGTGGAGGCGAACTGGTCATCAGCAGTGCCCAGCCCACTCTG
TCCTATCCATCCTCGCGACCCGAATCGGACTTCACGCTCGACCTGCCGCG
GGCGGAACAGCTGCGTCTGAAAATGGAGAAGGAGAAGAAGTTCCGCCAAA
GATGTCGCTTCATCACCACGTTCCTCAGCCTGGTCTTTTTCCTGCTGACT
GTGATGGTGGTCAGCCTGGTTCTGACGCGCGGCAAACGGATGTTTGGCAG
CATGATTGCAAGCTTTCTAGACCAT

BO27752.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG30377-RB 2694 CG30377-PB 1..2691 17..2707 13455 100 Plus
CG30377-RA 2694 CG30377-PA 1..2691 17..2707 13455 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG30377-RB 4078 CG30377-RB 912..3603 16..2707 13460 100 Plus
CG30377-RA 3414 CG30377-RA 248..2939 16..2707 13460 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7905441..7907444 503..2506 10020 100 Plus
2R 25286936 2R 7900952..7901440 16..504 2445 100 Plus
2R 25286936 2R 7914357..7914557 2507..2707 1005 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:04:29 has no hits.

BO27752.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:07 Download gff for BO27752.complete
Subject Subject Range Query Range Percent Splice Strand
CG30377-RA 1..2691 17..2709 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:36 Download gff for BO27752.complete
Subject Subject Range Query Range Percent Splice Strand
CG30377-RA 249..2939 17..2709 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:59 Download gff for BO27752.complete
Subject Subject Range Query Range Percent Splice Strand
CG30377-RA 249..2939 17..2709 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:59 Download gff for BO27752.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7914357..7914557 2507..2709 99   Plus
2R 7905443..7907444 505..2506 100 -> Plus
2R 7900953..7901440 17..504 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:36 Download gff for BO27752.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3801862..3802062 2507..2709 99   Plus
arm_2R 3792948..3794949 505..2506 100 -> Plus
arm_2R 3788458..3788945 17..504 100 -> Plus

BO27752.pep Sequence

Translation from 16 to 2725

> BO27752.pep
MPICKSSPGTASNKTATDISADHVTEAAQVKRTREQAYFNSYDFDAIEVL
PYEEEDDEAGGTSHSRSRSRSQSRSQSRCGSSSSRSSSTRSYSAAKEPVA
GHKFAYLQRLGAFFARNGGGAGESGSGEAAGIAAPSGGGASNAAPKGSSE
NFLLPRAMLKYQSTATASASPSSTSTAAVAMPLKNGLANGMGNAIGHDQQ
LEATGSAGERSKKCSIASNVSSTHSTDSGLPVAAAAVSASASASAAASAT
AATSAAAAAAAAQAARGGGGDGGGSHYSTDKSGSSGYYSSNVCSTYSLDE
HIYCEPVIDVQEKIKSVAARQRQRPPLQLPTKVGAPQEAPSIDPPEGSSE
KLSAVKSQRSDMQDAAGAAASNSHQTQSKAEAAEGLHHYSKKLRVLETSI
ENLDRHLKTFPSLYAQEHIVSFMQVAGARNEGPPQALDIGEKLRVYNQLP
TIMEQQQQQQQEQMVDDSLLDIDLDAFLLAPNAGHRGIDNPSFLNDEQLA
ENNYKCAKYINSCPEDAYRLESERGGAGGPGVGVAEETYVKRYEDQLHFQ
NTRELLEDVRDKIRLLSRATPPTSGTPTPASTPPSDVPKELEGMIHTLKH
ELESYLQRMNQHSELELRQLCSGLGRQQHVVRMQNALERRRSCADLQLNA
YEAVRDGVLISANGRPLSVREQIMTIRCASDPNFKMKRKSIAEIFPAAEC
YVESEVTTTSLSRSATPSPASTPQLELEALHPGLATTTIVTQMQRNLTFH
KPILAVSNSNPGGGNVTVDGAGGNKAERDRERESLAEWHRKKPSIWEMYY
GTNRLHQSLLGKQRGGGELVISSAQPTLSYPSSRPESDFTLDLPRAEQLR
LKMEKEKKFRQRCRFITTFLSLVFFLLTVMVVSLVLTRGKRMFGSMIASF
LDH

BO27752.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG30377-PB 897 CG30377-PB 1..897 1..897 4559 100 Plus
CG30377-PA 897 CG30377-PA 1..897 1..897 4559 100 Plus
sbb-PE 929 CG5580-PE 103..406 11..290 168 26 Plus
sbb-PC 929 CG5580-PC 103..406 11..290 168 26 Plus
sbb-PF 939 CG5580-PF 113..416 11..290 168 26 Plus