Clone BO27754 Report

Search the DGRC for BO27754

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:54
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO27754.pep: Imported from assembly
Sequenced Size:2449

Clone Sequence Records

BO27754.complete Sequence

2449 bp assembled on 2010-10-15

> BO27754.complete
GAAGTTATCAGTCGACATGTTGCAATCAACGGTTCCGTCATACCACCATC
CCCATCCGCATCACGGCCACCCTCATGCTCATCCCCATAGCCACCACCAT
GCGTCGATGCACCATGCCCATGCCCACCATGCTGCCGCTGCAGCTGCCGC
CCACCAGCGTGCGGTGCAGCAGGCCAACTATGGTGGTGGAGTCGGCGTGG
GCGTTGGCGTCGGTGTGGGCGTGGGCAGTGGCACGGGCAGCGCCTTCCAG
AGGCAGCCAGCTGCCGGCGGATTCCATCATGGCCATCATCAGGGCCGCAT
GCCGCGTCTGAATCGCAGCGTTTCGATGGAGCGTCTTCAGGACTTTGCCA
CCTACTTCAGTCCCATTCCGAGCATGGTGGGCGGGGTATCCGATATGTCA
CCGTATCCGCACCACTATCCCGGCTACTCCTATCAGGCGAGTCCCTCGAA
CGGAGCACCCGGCACTCCTGGCCAGCATGGTCAGTATGGCAGTGGCGCCA
ATGCTACCTTGCAGCCACCACCACCACCGCCGCCGCCGCATCACGCTGCC
ATGTTGCATCACCCGAATGCCGCCTTGGGCGACATCTGCCCCACCGGGCA
GCCCCACTACGGGCACAATCTGGGATCGGCTGTCACCTCCAGCATGCATC
TGACCAACTCCAGTCACGAGGCCGATGGAGCCGCCGCTGCTGCTGCCGCC
TACAAAGTGGAGCACGATTTGATGTACTACGGGAACACCTCATCGGACAT
TAACCAGACGGATGGCTTTATTAACTCCATTTTTACCGACGAGGATCTGC
ACTTGATGGACATGAATGAGAGCTTCTGTCGCATGGTTGACAACAGCACT
AGCAACAACTCCTCGGTTCTGGGCTTGCCCAGCAGTGGACATGTTAGCAA
CGGCTCCGGTAGCTCGGCACAACTTGGGGCGGGAAATCCGCACGGTAACC
AGGCCAACGGAGCGTCCGGCGGCGTTGGCTCGATGAGCGGATCAGCTGTG
GGCGCTGGAGCTACGGGAATGACCGCCGATCTTTTGGCAAGCGGCGGTGC
AGGAGCACAAGGCGGTGCGGATCGCTTGGACGCGTCCAGCGACAGTGCTG
TCAGTTCGATGGGCTCCGAGCGAGTGCCGTCCCTCTCCGACGGCGAGTGG
GGTGAGGGCAGTGACTCCGCCCAGGATTACCATCAGGGCAAGTACGGAGG
CCCCTACGACTTCAGCTACAACAATAATTCACGGCTTAGCACCGCCACAC
GTCAGCCGCCGGTGGCGCAGAAGAAGCATCAGCTGTACGGCAAGAGGGAT
CCCCATAAGCAGACGCCATCGGCTTTGCCACCAACAGCTCCACCAGCAGC
CGCGACTGCAGTCCAATCGCAGAGTATCAAGTACGAGTACGATGCTGGGT
ACGCCTCCTCGGGAATGGCCAGCGGTGGAATCAGTGAGCCAGGAGCGATG
GGACCCGCTCTATCCAAGGACTATCATCATCATCAGCCTTACGGCATGGG
AGCCAGCGGCAGCGCCTTTTCCGGCGACTATACAGTACGACCATCGCCAA
GGACTTCGCAGGATTTGGTGCAACTAAATCATACCTACTCGCTACCCCAG
GGAAGTGGATCCCTTCCCAGACCCCAGGCACGCGATAAGAAGCCCCTGGT
CGCCACTAAAACCGCATCGAAGGGAGCGAGTGCCGGCAACAGCAGCAGTG
TTGGCGGAAACAGCAGCAACTTGGAGGAAGAGCATCTGACACGCGATGAA
AAGCGCGCTCGATCCCTGAACATACCCATTTCAGTGCCGGACATCATTAA
CCTGCCCATGGACGAGTTCAACGAGCGCTTGTCGAAATACGACCTTAGCG
AGAACCAGTTGTCGCTGATTCGCGACATTCGTCGGCGTGGAAAGAACAAG
GTCGCTGCCCAGAATTGCAGGAAACGCAAATTGGACCAGATCCTGACTCT
AGAGGATGAGGTGAACGCGGTGGTTAAGCGCAAGACCCAACTTAATCAGG
ACCGCGATCATTTGGAGAGCGAACGCAAGCGCATCTCGAACAAGTTTGCC
ATGCTGCATCGTCATGTCTTCCAGTACCTACGGGATCCCGAGGGAAATCC
CTGCTCGCCGGCGGACTACAGTTTGCAACAGGCTGCCGATGGCTCCGTCT
ACTTGCTACCACGTGAAAAGTCCGAGGGTAACAACACGGCTACGGCTGCC
TCCAATGCTGTTTCGTCGGCCAGTGGGGGAAGTCTTAATGGCCACGTGCC
CACTCAGGCTCCCATGCACAGCCATCAGAGCCACGGAATGCAGGCGCAAC
ATGTTGTCGGTGGGATGTCGCAGCAGCAGCAACAGCAGTCGAGGCTGCCT
CCACACCTGCAACAGCAGCATCATCTGCAGTCGCAGCAACAGCAGCCGGG
AGGTCAGCAGCAACAGCAGCACCGCAAGGAAGCAAGCTTTCTAGACCAT

BO27754.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:04:58
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-RN 3402 CG43286-PN 981..3399 13..2431 11960 99.6 Plus
cnc-RM 3402 CG43286-PM 981..3399 13..2431 11960 99.6 Plus
cnc-RO 4293 CG43286-PO 1731..4149 13..2431 11960 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:05:00
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-RN 4746 CG43286-RN 1293..3711 13..2431 11960 99.6 Plus
cnc-RM 4737 CG43286-RM 1284..3702 13..2431 11960 99.6 Plus
cnc-RO 6701 CG43286-RO 2416..4834 13..2431 11960 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23187877..23189129 2074..822 6220 99.8 Minus
3R 32079331 3R 23191841..23192284 733..290 2175 99.3 Minus
3R 32079331 3R 23187447..23187806 2431..2072 1785 99.7 Minus
3R 32079331 3R 23197286..23197566 293..13 1375 99.3 Minus
3R 32079331 3R 23191695..23191784 822..733 450 100 Minus
Blast to na_te.dros performed 2014-11-26 15:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6859 2321..2427 242 72.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2289..2468 2255..2435 227 59.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6849 2321..2434 223 68.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6886 2321..2431 222 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2322..2427 2321..2423 207 68.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6847..6944 2320..2417 202 67.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6797..6900 2321..2421 198 67.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6817..6931 2320..2431 198 66.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2409..2513 2321..2427 178 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2376..2483 2321..2428 171 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2781..2871 2321..2417 164 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2456..2536 2320..2397 163 70.4 Plus
roo 9092 roo DM_ROO 9092bp 1090..1163 2320..2393 154 67.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2594..2665 2320..2391 144 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2805..2915 2321..2435 134 61.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1539..1587 2324..2372 119 71.4 Plus

BO27754.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:07 Download gff for BO27754.complete
Subject Subject Range Query Range Percent Splice Strand
cnc-RB 854..3263 22..2433 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:38 Download gff for BO27754.complete
Subject Subject Range Query Range Percent Splice Strand
cnc-RO 2425..4834 22..2433 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:06:09 Download gff for BO27754.complete
Subject Subject Range Query Range Percent Splice Strand
cnc-RO 2425..4834 22..2433 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:06:09 Download gff for BO27754.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23197287..23197557 22..292 99   Minus
3R 23191841..23192281 293..733 99 <- Minus
3R 23191696..23191783 734..821 100 <- Minus
3R 23187877..23189129 822..2074 99 <- Minus
3R 23187444..23187803 2075..2433 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:38 Download gff for BO27754.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19023009..19023279 22..292 99   Minus
arm_3R 19017563..19018003 293..733 99 <- Minus
arm_3R 19017418..19017505 734..821 100 <- Minus
arm_3R 19013599..19014851 822..2074 99 <- Minus
arm_3R 19013166..19013525 2075..2433 99 <- Minus

BO27754.pep Sequence

Translation from 16 to 2449

> BO27754.pep
MLQSTVPSYHHPHPHHGHPHAHPHSHHHASMHHAHAHHAAAAAAAHQRAV
QQANYGGGVGVGVGVGVGVGSGTGSAFQRQPAAGGFHHGHHQGRMPRLNR
SVSMERLQDFATYFSPIPSMVGGVSDMSPYPHHYPGYSYQASPSNGAPGT
PGQHGQYGSGANATLQPPPPPPPPHHAAMLHHPNAALGDICPTGQPHYGH
NLGSAVTSSMHLTNSSHEADGAAAAAAAYKVEHDLMYYGNTSSDINQTDG
FINSIFTDEDLHLMDMNESFCRMVDNSTSNNSSVLGLPSSGHVSNGSGSS
AQLGAGNPHGNQANGASGGVGSMSGSAVGAGATGMTADLLASGGAGAQGG
ADRLDASSDSAVSSMGSERVPSLSDGEWGEGSDSAQDYHQGKYGGPYDFS
YNNNSRLSTATRQPPVAQKKHQLYGKRDPHKQTPSALPPTAPPAAATAVQ
SQSIKYEYDAGYASSGMASGGISEPGAMGPALSKDYHHHQPYGMGASGSA
FSGDYTVRPSPRTSQDLVQLNHTYSLPQGSGSLPRPQARDKKPLVATKTA
SKGASAGNSSSVGGNSSNLEEEHLTRDEKRARSLNIPISVPDIINLPMDE
FNERLSKYDLSENQLSLIRDIRRRGKNKVAAQNCRKRKLDQILTLEDEVN
AVVKRKTQLNQDRDHLESERKRISNKFAMLHRHVFQYLRDPEGNPCSPAD
YSLQQAADGSVYLLPREKSEGNNTATAASNAVSSASGGSLNGHVPTQAPM
HSHQSHGMQAQHVVGGMSQQQQQQSRLPPHLQQQHHLQSQQQQPGGQQQQ
QHRKEASFLDH

BO27754.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:13:11
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-PO 1430 CG43286-PO 579..1387 1..809 4287 99.5 Plus
cnc-PN 1133 CG43286-PN 329..1133 1..805 4281 99.9 Plus
cnc-PM 1133 CG43286-PM 329..1133 1..805 4281 99.9 Plus
cnc-PL 1046 CG43286-PL 242..1046 1..805 4281 99.9 Plus
cnc-PK 1383 CG43286-PK 579..1383 1..805 4281 99.9 Plus