Clone BO27771 Report

Search the DGRC for BO27771

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptVago-RB
Protein status:BO27771.pep: Imported from assembly
Sequenced Size:514

Clone Sequence Records

BO27771.complete Sequence

514 bp assembled on 2010-08-18

GenBank Submission: KX793786

> BO27771.complete
GAAGTTATCAGTCGACATGGAGTCAATTAGCAGCATGATTTATTTAGTGG
CCATGATGTCATTGATCATCGGTGGCAGCCAAGCGATTCCTTATCGACCC
TCGGCGTATCTGTACAATCAGCAGTACTGTATGGATACATTGACGGGTCG
GCAGCTTTATATCGGTGAAGTCTTCACGCGAGAGGATCAGTGCGTCCGCA
TCCAATGCCTGGAAACGCTGCAACTCTGGGAGGATAGCTGCCAGGTGCCG
AAACTGACGCAGGGCAATTGCACGCCAGTTCCATCGACGAACCCGCATGC
CGAATATCCCCGATGCTGCCCACTGTATGAGTGCAAGAGCTACGAGTCGA
ATTCGGGGGGAACTCTGGAGCAGACCAACATATATGACCACTATGGTACT
CTGCGATCATCCCATCTCACTGAGATGATAGTGATCGACGGGCGGACACC
CCCTCGTGGCGAGATTCACACGGCGTCGGCGAGGAAGTATCAGGTGGCAA
GCTTTCTAGACCAT

BO27771.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Vago-RD 483 CG2081-PD 1..480 17..496 2400 100 Plus
Vago-RB 483 CG2081-PB 1..480 17..496 2400 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Vago-RD 796 CG2081-RD 82..561 17..496 2400 100 Plus
Vago-RB 684 CG2081-RB 82..561 17..496 2400 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11089724..11089984 236..496 1305 100 Plus
X 23542271 X 11089521..11089659 99..237 695 100 Plus
X 23542271 X 11089371..11089452 17..98 410 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:37:01 has no hits.

BO27771.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:54:50 Download gff for BO27771.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 82..561 17..498 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:18:08 Download gff for BO27771.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 82..561 17..498 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:15:03 Download gff for BO27771.complete
Subject Subject Range Query Range Percent Splice Strand
Vago-RB 82..561 17..498 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:15:03 Download gff for BO27771.complete
Subject Subject Range Query Range Percent Splice Strand
X 11089726..11089984 238..498 99   Plus
X 11089521..11089659 99..237 100 -> Plus
X 11089371..11089452 17..98 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:18:08 Download gff for BO27771.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10983759..10984017 238..498 99   Plus
arm_X 10983554..10983692 99..237 100 -> Plus
arm_X 10983404..10983485 17..98 100 -> Plus

BO27771.pep Sequence

Translation from 16 to 514

> BO27771.pep
MESISSMIYLVAMMSLIIGGSQAIPYRPSAYLYNQQYCMDTLTGRQLYIG
EVFTREDQCVRIQCLETLQLWEDSCQVPKLTQGNCTPVPSTNPHAEYPRC
CPLYECKSYESNSGGTLEQTNIYDHYGTLRSSHLTEMIVIDGRTPPRGEI
HTASARKYQVASFLDH

BO27771.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
Vago-PD 160 CG2081-PD 1..160 1..160 864 100 Plus
Vago-PB 160 CG2081-PB 1..160 1..160 864 100 Plus