Clone BO27787 Report

Search the DGRC for BO27787

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:87
Vector:pDNR-Dual
Associated Gene/TranscriptCG9772-RB
Protein status:BO27787.pep: Imported from assembly
Sequenced Size:1777

Clone Sequence Records

BO27787.complete Sequence

1777 bp assembled on 2010-09-13

GenBank Submission: KX799870

> BO27787.complete
GAAGTTATCAGTCGACATGGCGGTCTTGTTTTTATCGTCACATGGCGCCT
CCAGGCATTGGCGGTTGCGGAGGCCGAGTCGCTGGGCGTACAACAGGATG
GCGATATTCAGCAGCACAACGACGGTGGATACCACGACCAGAAAGCGCTC
GACTAATAAGAACCACGTCTCTGTTGTGGGCGCTCTAGTTTCCACTACGA
AGTCATCGCACTACGAGCACCCTTCCTCGCCCTCGGCACTAACTTTTGAG
GCCCTAGAAGAGATGGGAATCGGAATGCTTGATTCCGAAGAAAGCAGCTC
CTCAGCCCTCTCGGCCATCGCTTTGGCGGTTAGCGCCACCAGCGACGACA
ACTCAAATGAGACGACCCCGTGCGCCAGTGTGTCGCGCATGGCGCACCAG
CTACAGCACACGCAACGGCTAAGTCTGGGCTCTACGGGGGACATCACACT
GGATAGCCCAGCTGTGGAGGATTCACTGTCGATGTCCCGTCAATCGGCCG
AGAAGCTGCAGATTCTGGCGCAGGCTAAGCGCTCGTCGTTGGGTTCTGAA
GGTAGCGGCAATTCAAACTCGCCCAGCAAACGTTTGCGCAACCCCCTGGC
TGCAGTCACCTGTAACAACCAGATTGATGGGACTGCTTCGCTCAATTTTC
AGCCATCAACCAGCAGGTTGGCGCAAGTTCGCCAGGCAAAAAAGCCCTCG
ACAACAAATATTACAACCCGAATAGTGGCAGCGGACAGTTTCTTTGTGTT
TCGCACCCCGGCCATGAGTGCCCACATCAACAGCGGCATAAACTACTTTG
AAAGACTTTCAGACGAAATACTACTTGACATCTTTAAGTGGCTCCCGAAG
AAGACGCTGCTGCGCATGGCTACCGTTTGTCGACGCTTTAACCGCTGCTC
TCGCGATGAGACTTTGTGGACAAGGCTAGATTTGGGTTTGCGGACAATTA
GACCAGGTGCCCTCGAGCAAATTGTACGGCGGGGAGTCCTTGTAATACGT
CTGGCCCAGACTAGTATCCAGGAGCCCGCATTTGCACCATATACAGAAGT
GTTTAGGACCCGATTACAATATCTTGACCTGAGTATGGCTTCCATCACCC
GAAGCTCACTGCTGACACTATTGTCCCACTGCCGCCAGCTAAAGAAAATA
AGCTTAGAGAATATTGAGCTCGATGATGACATCTGTGCAGAGATCGCAAA
GAATGAAGCTTTGGAGGCGGTCAATCTGACTATGGCTAGTGGCCTGACGT
CCAACAGTGTTCGCCTGATGATGGAGTCACTTACCAGCCTAAGCAGCTTA
AACATATCGTGGACTGACCTAAGTGCGGATGCTGTTACGGCGTTGGTTAC
CCACATTTCCCCCAACTTAATTCGGCTCAATATCGCTGGCTGCCGCCGCG
TTTTGTTTGACTCGCATGTTGCAACCCTGCAAAAACGGTGTCCTCAGTTG
TTGGAGCTTGATCTATCTGATTGCAATAGTCTAACACCAACAGTCATTAC
TGCAATTATGAAGTTCAAGATGCTGGAATATTTGTCCGTCTCCCGATGCT
ATCTTATTCCAGCAACCAAATTTATTGAACTTAAGAGTATGCCCTCGCTA
ACCTATTTAGACATATTTGGGATGCTGTCGGACACTGCAATGGAAGTCCT
TGAGAAACAACTGCCAAAAATGGGTATAAACAAATTCATTCACAGTTCGG
TATCCCGCCCGACTGTTGGCACGCGACGCACCTCCATTTGGGGTCTGCGC
ACGCGCGACGCAAGCTTTCTAGACCAT

BO27787.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:22:17
Subject Length Description Subject Range Query Range Score Percent Strand
Skp2-RE 1680 CG9772-PE 54..1677 136..1759 8120 100 Plus
Skp2-RA 1680 CG9772-PA 54..1677 136..1759 8120 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
Skp2-RE 1853 CG9772-RE 122..1745 136..1759 8120 100 Plus
Skp2-RA 2412 CG9772-RA 122..1745 136..1759 8120 100 Plus
CG1103-RB 1223 CG1103-RB 676..800 141..17 625 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4336469..4337345 1015..139 4385 100 Minus
3R 32079331 3R 4336009..4336408 1415..1016 2000 100 Minus
3R 32079331 3R 4335546..4335729 1759..1576 920 100 Minus
3R 32079331 3R 4335786..4335945 1575..1416 800 100 Minus
3R 32079331 3R 4339367..4339491 141..17 625 100 Minus
Blast to na_te.dros performed on 2014-11-28 05:22:16 has no hits.

BO27787.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-16 10:43:57 Download gff for BO27787.complete
Subject Subject Range Query Range Percent Splice Strand
CG9772-RB 75..1817 17..1761 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:26:12 Download gff for BO27787.complete
Subject Subject Range Query Range Percent Splice Strand
Skp2-RB 75..1817 17..1761 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:09:43 Download gff for BO27787.complete
Subject Subject Range Query Range Percent Splice Strand
Skp2-RA 122..1745 136..1761 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:09:43 Download gff for BO27787.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4339367..4339491 17..141 100   Minus
3R 4336469..4337342 142..1015 100 <- Minus
3R 4336009..4336408 1016..1415 100 <- Minus
3R 4335786..4335945 1416..1575 100 <- Minus
3R 4335544..4335729 1576..1761 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:26:12 Download gff for BO27787.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 165089..165213 17..141 100   Minus
arm_3R 162191..163064 142..1015 100 <- Minus
arm_3R 161731..162130 1016..1415 100 <- Minus
arm_3R 161508..161667 1416..1575 100 <- Minus
arm_3R 161266..161451 1576..1761 98 <- Minus

BO27787.pep Sequence

Translation from 16 to 1777

> BO27787.pep
MAVLFLSSHGASRHWRLRRPSRWAYNRMAIFSSTTTVDTTTRKRSTNKNH
VSVVGALVSTTKSSHYEHPSSPSALTFEALEEMGIGMLDSEESSSSALSA
IALAVSATSDDNSNETTPCASVSRMAHQLQHTQRLSLGSTGDITLDSPAV
EDSLSMSRQSAEKLQILAQAKRSSLGSEGSGNSNSPSKRLRNPLAAVTCN
NQIDGTASLNFQPSTSRLAQVRQAKKPSTTNITTRIVAADSFFVFRTPAM
SAHINSGINYFERLSDEILLDIFKWLPKKTLLRMATVCRRFNRCSRDETL
WTRLDLGLRTIRPGALEQIVRRGVLVIRLAQTSIQEPAFAPYTEVFRTRL
QYLDLSMASITRSSLLTLLSHCRQLKKISLENIELDDDICAEIAKNEALE
AVNLTMASGLTSNSVRLMMESLTSLSSLNISWTDLSADAVTALVTHISPN
LIRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLTPTVITAIMKF
KMLEYLSVSRCYLIPATKFIELKSMPSLTYLDIFGMLSDTAMEVLEKQLP
KMGINKFIHSSVSRPTVGTRRTSIWGLRTRDASFLDH

BO27787.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Skp2-PE 559 CG9772-PE 19..559 41..581 2693 100 Plus
Skp2-PA 559 CG9772-PA 19..559 41..581 2693 100 Plus