Clone BO27789 Report

Search the DGRC for BO27789

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:89
Vector:pDNR-Dual
Associated Gene/Transcriptl(1)G0232-RC
Protein status:BO27789.pep: Imported from assembly
Sequenced Size:2425

Clone Sequence Records

BO27789.complete Sequence

2425 bp assembled on 2010-10-15

GenBank Submission: KX794579

> BO27789.complete
GAAGTTATCAGTCGACATGGAGGCAGAACAACAAGAATTCGCTGTGAAAC
AATTCATTGATCTCTGCAACAATCTAGGTGCTAACTGCAGCACGACGACA
GCCACATCCCCGTCAACTTCCTCCTCCTCAGCCAGCAGCACGCAGAACTT
AATAGCAGTAGTGCCGCCACAGTTGCAGCAGCTGCAGGTGCAATTACCGG
CGCCAGGTGGAGGAGGAGGAGCAGGTGCAGGAGGAGGAGGTGGTGGAGGT
GGGGGAGCTGCGCCTGTGAGGCGCCACATCTCGCATACGACAGCCGTGAA
GTTTTTGTACGCCCGTAAATTTGATATACCACGAGCAGTCTCACTGTACG
AACAGCATGAACAGATCCGCCTGAAGGAGTATCTATATAACATCGATCCG
GATGTGGAGCCCTTGCGCTCCGAGTTGCAGACCGGCAAGTTCACAATCCT
GCCCGCACGCACTTCCAGTGGCGCTGCCATCGCCCTTTTCACCGCCAATC
GACACAGTCCGCTGAGCGTTTCGCACACAACCACGCTGCAGGGCATCGTC
TATCAGCTGGACAGTGCGCTCCAGGATTCGGAGACGCAGCGTGCCGGGCT
CGTTTTTATCTACGACATGAGCGGCTCCAAGTATTCCAACTTCGACTACG
ACCTCTCCCAGAAGATTCTCACACTGCTTAAGGGCGGCTATCCAGCGCGT
CTGAAGAAGGTCCTGATCGTGACGGCGCCACTGTGGTTCAAGGCACCCTT
CAAGATCCTGCGTCTGTTCGTGCGCGAGAAGCTGCGCGAGCGAGTGTTCA
CTGTATCGGTGCCTCAATTGGCGCTGCACGTGCCGCGCAAGGCGCTGCCC
ATTCACTTGGGTGGCACGCTGGAGGTCGATCACGCCACATGGTTGCTCAG
CTGCCGCCAATCGATGACGAATCGTGAGGACGAGCTGCTGGCCAATATCG
TGGGTGTGGGCGGTGGATCCGGATCCGGTTCAGCAGCTGGATCAGCAGCA
ATTGTGTCCACCAATGGCACGGAAACCGAGGCCGCGACAACGGCAGCCAC
GATAATCAGCGCCGTCCACCAGTTGGGCGATAATAATACCACCGTGGTGA
CGGTCAGCAATGGCGTCGGTCCAGCTGGATCGGCATCTGGCGGAGCAACG
ACAGCAGCGTCGGCGGCGACGGAACCCAACGAAAATATCACAATCAACGG
ACTGAGTCCAAGCCACCGTCAGGCGGCGAATAACAGCAGTAGCAGTAGCA
GCAGTGCAGCCACAGTGGCCAATCCCCTCAAGCTCAACACAAGTGGCTCC
GCGGACAACAATAGTACCATCACGAACGCCACCACAGCTGCTGGAGCAGC
CGGAGCAGCTGCTGGCACCACCACCAATGGCGGCGGCGAGTTCTGGTCAG
AGAATCCACCCAGCAGCGCCTCATCCGGCTTCAGTGACGATGATAGTCTC
GCCGGTCAAGAGGGCGATCCCAAGCCCATTGATCAGATTGTTCAGATGGT
TAAGCAGCGCGGACGCCATGGTCTGATTAAGGAGTACGCGGACATTCGGA
ATAGGGCGCCCGAGGGCACCTTTCTGCATGCGAGAATGCGGGCCAATCTG
ACCAAGAATCGCTACACAGACGTCCTCTGCTACGATCACAGTCGAGTTGT
TCTGGCACACGAAGACGGCGACGAGCCGTCGGATTATATTAATGCGAATT
TCGTCGATGGCTACAAACAAAAGAATGCCTATATTTCAACTCAAGGTCCA
TTACCAAAGACATCCCAGGACTTTTGGCGCATGATCTGGGAACAACATTG
TTTAGTTATAGTGATGACGACGCGCGTGATGGAGCGCGGACGCGTGAAAT
GCGGCCAGTACTGGGAGCCGACTGAAGAAAGTTCCTTAGAGTTTGGCGAC
TACCATGTGCGAACAATTAGCGTTGAGTGCAACGAGGACTATATGGTTGC
CTCGTTAGAATTGAGAAACATAAAGACTGACGAAATTCGCAATGTCTCAC
ATTGGCAGTTCACCAGCTGGCCGGACTATGGCGTTCCCAGCTCGGCCATG
GCCATGCTGAACTTCCTGCAGAAGGTGCGTGAGAAGCAGGCGCAGCTTGT
CCAAGGACTGGGCGACACCTGGGCGGGTCATCCCCGTGGACCGCCCATTG
TGGTGCACTGCAGTGCAGGCATTGGACGCACAGGTACATTCATCACCCTG
GACATTTGCATATCGCGCCTGGAGGACGTGGGCACGGCGGACATACGTGG
AACGGTTGAGAAGATCCGGTCGCAGCGAGCCTACTCCATTCAGATGCCCG
ATCAGTACGTGTTCTGTCACCTGGCCCTCATCGAATACGCATATTCGCGT
GGAATGCTACAGACGGTCGATCTGGCTGGCTTCGATGAGCGCGAACCGGA
CTCGGAGGCAAGCTTTCTAGACCAT

BO27789.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0232-RC 2394 CG32697-PC 1..2391 17..2407 11955 100 Plus
l(1)G0232-RG 2373 CG32697-PG 4..2370 41..2407 11835 100 Plus
l(1)G0232-RA 2484 CG32697-PA 115..2481 41..2407 11835 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0232-RC 3053 CG32697-RC 276..2666 17..2407 11955 100 Plus
l(1)G0232-RG 5668 CG32697-RG 488..2854 41..2407 11835 100 Plus
l(1)G0232-RF 5646 CG32697-RF 466..2832 41..2407 11835 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9630194..9631097 1584..681 4520 100 Minus
X 23542271 X 9643957..9644367 451..41 2055 100 Minus
X 23542271 X 9643656..9643888 683..451 1165 100 Minus
X 23542271 X 9629668..9629899 1975..1744 1160 100 Minus
X 23542271 X 9629109..9629336 2407..2180 1140 100 Minus
X 23542271 X 9629394..9629605 2185..1974 1060 100 Minus
X 23542271 X 9629961..9630125 1747..1583 825 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:01:08 has no hits.

BO27789.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:22:58 Download gff for BO27789.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0232-RC 45..2435 17..2409 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:11 Download gff for BO27789.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0232-RC 276..2666 17..2409 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:48 Download gff for BO27789.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0232-RC 276..2666 17..2409 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:48 Download gff for BO27789.complete
Subject Subject Range Query Range Percent Splice Strand
X 9658847..9658870 17..40 100   Minus
X 9643957..9644367 41..451 100 <- Minus
X 9643657..9643887 452..682 100 <- Minus
X 9630194..9631095 683..1584 100 <- Minus
X 9629963..9630123 1585..1745 100 <- Minus
X 9629668..9629897 1746..1975 100 <- Minus
X 9629396..9629603 1976..2183 100 <- Minus
X 9629107..9629332 2184..2409 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:11 Download gff for BO27789.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9552880..9552903 17..40 100   Minus
arm_X 9537990..9538400 41..451 100 <- Minus
arm_X 9537690..9537920 452..682 100 <- Minus
arm_X 9524227..9525128 683..1584 100 <- Minus
arm_X 9523996..9524156 1585..1745 100 <- Minus
arm_X 9523701..9523930 1746..1975 100 <- Minus
arm_X 9523429..9523636 1976..2183 100 <- Minus
arm_X 9523140..9523365 2184..2409 99 <- Minus

BO27789.pep Sequence

Translation from 16 to 2425

> BO27789.pep
MEAEQQEFAVKQFIDLCNNLGANCSTTTATSPSTSSSSASSTQNLIAVVP
PQLQQLQVQLPAPGGGGGAGAGGGGGGGGGAAPVRRHISHTTAVKFLYAR
KFDIPRAVSLYEQHEQIRLKEYLYNIDPDVEPLRSELQTGKFTILPARTS
SGAAIALFTANRHSPLSVSHTTTLQGIVYQLDSALQDSETQRAGLVFIYD
MSGSKYSNFDYDLSQKILTLLKGGYPARLKKVLIVTAPLWFKAPFKILRL
FVREKLRERVFTVSVPQLALHVPRKALPIHLGGTLEVDHATWLLSCRQSM
TNREDELLANIVGVGGGSGSGSAAGSAAIVSTNGTETEAATTAATIISAV
HQLGDNNTTVVTVSNGVGPAGSASGGATTAASAATEPNENITINGLSPSH
RQAANNSSSSSSSAATVANPLKLNTSGSADNNSTITNATTAAGAAGAAAG
TTTNGGGEFWSENPPSSASSGFSDDDSLAGQEGDPKPIDQIVQMVKQRGR
HGLIKEYADIRNRAPEGTFLHARMRANLTKNRYTDVLCYDHSRVVLAHED
GDEPSDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVM
TTRVMERGRVKCGQYWEPTEESSLEFGDYHVRTISVECNEDYMVASLELR
NIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGD
TWAGHPRGPPIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKI
RSQRAYSIQMPDQYVFCHLALIEYAYSRGMLQTVDLAGFDEREPDSEASF
LDH

BO27789.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0232-PC 797 CG32697-PC 1..797 1..797 4120 100 Plus
l(1)G0232-PB 802 CG32697-PB 11..802 6..797 4083 99.7 Plus
l(1)G0232-PG 790 CG32697-PG 2..790 9..797 4080 100 Plus
l(1)G0232-PA 827 CG32697-PA 39..827 9..797 4080 100 Plus
l(1)G0232-PF 597 CG32697-PF 1..597 201..797 3103 100 Plus