Clone BO27790 Report

Search the DGRC for BO27790

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCG32549-RE
Protein status:BO27790.pep: Imported from assembly
Sequenced Size:1924

Clone Sequence Records

BO27790.complete Sequence

1924 bp assembled on 2010-10-15

GenBank Submission: KX797752

> BO27790.complete
GAAGTTATCAGTCGACATGCCACAGCCAAAGCAAAACCAGCAGAAACAGC
CACAGCCACAACAGCAAAAGCCGCTGCAGAAACATTCCAGCACCAGCTCC
ACGATCATCGCCAAGCCGGAAAAGGAACGGGAACGCACGCAGACGATCGG
CGAAACCGACATGGATCAGTCGGTGCTCAATGGACTGGCAGTGGGCGCAG
ATGGAACCGCCGGCTACCATGGTCACAAGCGAGAACTTGGTCACAGAGTG
TTTGTGAACAGATCGCTGCATTTGGAGAATATCAAGTACTATGGCTTCGA
TATGGACTACACCTTGGCAGAGTACAAGTCACCGCAGTATGAGCAGCTGG
GCTTCAACCTGGTCAAGGAGCGCCTGGTCTTCATGGGCTACCCCAAGGAG
ATCCTGCAGTTCGAGTACGATCCCACCTTCCCAGTACGCGGCCTGTGGTT
CGACACTCTCTACGGGAATCTGCTGAAAGTGGATGCCTACGGCAACATCC
TGGTCTGCGTTCATGGCTTCGAGTTCATCAAACATCACCAGGTGTACGAG
TTGTATCCCAACAAGTTCTTGAAACTGGACGAGTCGCGTGTCTATGTCCT
GAATACTCTCTTCAATCTTCCTGAAACCTATCTCCTTGCCTGTCTCGTCG
ACTTCCTAACCAACAGCAGCGACTTTGTGCGCGTTGAGCGCGGCATCAAA
GCTGGCGATTTACTTTTTACCTACAAGTCGATTTTCCAGGATGTGCGACG
TGCCGTCGACTGGGTGCATTCCGATGGCGATCTGAAGCGTCGCACCACTC
AGAATATGGCTCACTATGTGAAGAAGGACGAGCGTTTGCCCACGGTCCTT
TCGCGAATCCGGGAGTCGGGCGCCAAACTCTTTATGCTGACCAACAGCGA
CTATACGTACACCAACGAGATCATGACCTACCTGTTTGATTTCCCCCATG
GCGCCACTCCGGATGAGCCGCATCGCGACTGGAAGACCTACTTCGATGTG
ATCGTGGTGGATGCCCGCAAGCCGCTCTTCTTCGACGAGGGCACCGTGCT
GCGGCAGGTGGACACGAAGACCGGAAGCCTGAAGATCGGCACACACGTTG
GACCCCTGCAGCCGGGTCAGGTTTATTCCGGTGGCTCCTGCGAGCTCTTT
ACCAAGTTCATCAATGCCAAAGGCAAGGACGTGCTCTATGTGGGCGATCA
CATTTTTGGCGATATTCTCAAATCGAAGAAGATTCGAGGCTGGCGCACCT
TCCTAATTGTGCCCGAATTGGTGAGGGAGCTGCACGTTTGGACGGATGAG
TGCCAGCTGTTTGCGGAGCTACAGAACCTGGACATCAAGCTGGGCGACCT
GTACAGGGATCTCGACTCGAGTGCCAAGGTCAAGCCGGACATTTCGCAGC
TGCGCACGTGCATCCGCGATGTGACACACAAGATGGACATGTCCTACGGT
ATGATGGGCTCACTCTTCCGCTCCGGCTCGCGCCAGACCTTCTTCTCCAG
CCAGGTGGTGCGATATGCCGACGTCTATGCGGCCACCCTGCTCAACCTCA
TTTACTACCCATTCTCGTATATGTTCCGAGCTCCGGCCATGCTTCTGCCC
CATGAGTCGACGGTGGCCCATGATCAGGCCCATCAGCCGCCTCCGCCACT
GGGCCCTGTTCCTGTTCCGGCTACGGGAGCCGCATCGGTGGCTGCCTCGC
CGGATGAGCCGGCTCGCATTTTGGCGGGCACCGCCGAGCACGTTAAGGAC
CCCAAGGACTTGCATCGCGCAAGCTCCATTGTGCACACTCGTCCGTCGAC
GCCCACCGTGGTGACCCACACCCATGACGAGGACTATTCCGAGGAGGAGG
AGACACCCAGTGGTGCCGAGTCTTCCACAGAGGCTGTGCGCGATGCCTCC
GAAGACGCAAGCTTTCTAGACCAT

BO27790.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG32549-RE 1893 CG32549-PE 1..1890 17..1906 9450 100 Plus
CG32549-RH 2130 CG32549-PH 463..2127 242..1906 8325 100 Plus
CG32549-RG 2130 CG32549-PG 463..2127 242..1906 8325 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG32549-RE 2509 CG32549-RE 372..2261 17..1906 9450 100 Plus
CG32549-RH 2677 CG32549-RH 771..2435 242..1906 8325 100 Plus
CG32549-RG 2806 CG32549-RG 900..2564 242..1906 8325 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18390998..18391968 1771..801 4855 100 Minus
X 23542271 X 18403985..18404214 246..17 1150 100 Minus
X 23542271 X 18392549..18392765 534..318 1085 100 Minus
X 23542271 X 18392335..18392481 681..535 735 100 Minus
X 23542271 X 18390798..18390932 1906..1772 675 100 Minus
X 23542271 X 18392040..18392161 802..681 610 100 Minus
X 23542271 X 18392837..18392914 320..243 390 100 Minus
Blast to na_te.dros performed 2014-11-26 15:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6853..6947 19..114 180 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2595..2678 35..116 163 70.9 Plus

BO27790.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:01 Download gff for BO27790.complete
Subject Subject Range Query Range Percent Splice Strand
CG32549-RE 349..2238 17..1908 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:19 Download gff for BO27790.complete
Subject Subject Range Query Range Percent Splice Strand
CG32549-RE 372..2261 17..1908 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:12 Download gff for BO27790.complete
Subject Subject Range Query Range Percent Splice Strand
CG32549-RE 372..2261 17..1908 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:12 Download gff for BO27790.complete
Subject Subject Range Query Range Percent Splice Strand
X 18403985..18404214 17..246 100   Minus
X 18392837..18392910 247..320 100 <- Minus
X 18392549..18392762 321..534 100 <- Minus
X 18392335..18392481 535..681 100 <- Minus
X 18392040..18392160 682..802 100 <- Minus
X 18390998..18391966 803..1771 100 <- Minus
X 18390796..18390932 1772..1908 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:19 Download gff for BO27790.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18298018..18298247 17..246 100   Minus
arm_X 18286870..18286943 247..320 100 <- Minus
arm_X 18286582..18286795 321..534 100 <- Minus
arm_X 18286368..18286514 535..681 100 <- Minus
arm_X 18286073..18286193 682..802 100 <- Minus
arm_X 18285031..18285999 803..1771 100 <- Minus
arm_X 18284829..18284965 1772..1908 98 <- Minus

BO27790.pep Sequence

Translation from 16 to 1924

> BO27790.pep
MPQPKQNQQKQPQPQQQKPLQKHSSTSSTIIAKPEKERERTQTIGETDMD
QSVLNGLAVGADGTAGYHGHKRELGHRVFVNRSLHLENIKYYGFDMDYTL
AEYKSPQYEQLGFNLVKERLVFMGYPKEILQFEYDPTFPVRGLWFDTLYG
NLLKVDAYGNILVCVHGFEFIKHHQVYELYPNKFLKLDESRVYVLNTLFN
LPETYLLACLVDFLTNSSDFVRVERGIKAGDLLFTYKSIFQDVRRAVDWV
HSDGDLKRRTTQNMAHYVKKDERLPTVLSRIRESGAKLFMLTNSDYTYTN
EIMTYLFDFPHGATPDEPHRDWKTYFDVIVVDARKPLFFDEGTVLRQVDT
KTGSLKIGTHVGPLQPGQVYSGGSCELFTKFINAKGKDVLYVGDHIFGDI
LKSKKIRGWRTFLIVPELVRELHVWTDECQLFAELQNLDIKLGDLYRDLD
SSAKVKPDISQLRTCIRDVTHKMDMSYGMMGSLFRSGSRQTFFSSQVVRY
ADVYAATLLNLIYYPFSYMFRAPAMLLPHESTVAHDQAHQPPPPLGPVPV
PATGAASVAASPDEPARILAGTAEHVKDPKDLHRASSIVHTRPSTPTVVT
HTHDEDYSEEEETPSGAESSTEAVRDASEDASFLDH

BO27790.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG32549-PE 630 CG32549-PE 1..630 1..630 3331 100 Plus
CG32549-PH 709 CG32549-PH 151..709 72..630 2941 99.5 Plus
CG32549-PG 709 CG32549-PG 151..709 72..630 2941 99.5 Plus
CG32549-PF 612 CG32549-PF 54..612 72..630 2941 99.5 Plus
CG32549-PB 612 CG32549-PB 54..612 72..630 2941 99.5 Plus