Clone BO27792 Report

Search the DGRC for BO27792

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:277
Well:92
Vector:pDNR-Dual
Associated Gene/TranscriptPole2-RA
Protein status:BO27792.pep: Imported from assembly
Sequenced Size:1609

Clone Sequence Records

BO27792.complete Sequence

1609 bp assembled on 2010-10-15

GenBank Submission: KX799492

> BO27792.complete
GAAGTTATCAGTCGACATGGATGTGGATTTACTGCCGCTGAGAAAGCGAA
TAACGAACACTTTCAAGTTATGTGGATTCCTGATCCGCTCGGAGAACAGT
TCCTACCTGGCGGAGCAGCTGCTGCCCTTCGACGCAGCGGAACGGGACAA
ATGGCTGACGGTGATCACCGAGAATCTCCAAAGCCAAAAGCTTTTGACGC
CTCATGTGGAGCGAGCCGCCCTGGAGAAGGCTATCAATGAACTTAACCGG
GTGGGATTGGATGAAGGGGAGACGGTCTTTGCCCTGATCGATGCCTTTAC
GGTGCCCCGTTTTCGGTACAACCAGCGGATAAAGAAATTCGAACTGGACA
CACAGCCGCGCCAGTTGCTGACCGCTCCGCGCATGAAATCGGACTACATG
CAGCAACGATATGCCATGTTACTACAGAAAACTCTGCGACACGACCTCTT
TGCCCCAGCCGTCATCCAGGATGGCGTTGGAGCCGAGGCCCAGGCCAAGA
AATTTAAGCTCCAGTTCGCTGAGAACCTGCTGGCCACGTCGGCGATGAAG
GAGGCAGTTGTTTTGGGACTACTTACCCAGCTTAAGGAGGGCAAGTTCTA
TGTCGAGGATCCCACGGGTTGCGTCCAGTTAGATCTCACTGGAGCCCGTT
TCCATGCCGGCTTCTTCTGCGAGGGCTGCTTTGTTTTAGCCGAGGGCAAC
TATAACAACGGTGTGCTCAAGGTTGATGGCCTGGGCTTTCCACCCGCGGA
ACCGGCAAACAGCAGTCGAGCATTTTTCGGCACCGCCAACACTTGGGGCG
GTGAATCTGCTAAGCTGCTGAAGTACTCAGCCGGACTACAGGAACTGGAG
CGTACCAACACGGAAACAACCATTGTTTTCCTTTCCGACGTACGGTTGGA
TCTGCCGGTTGTCATGGAGAAGCTGCGCCAGTTGTTCGTGGGCTATGATT
CCTGCCCGCCGCAAGCTATAGTGCTCATGGGCCCCTTCACGGCCAGCACA
AGGAATCATCATGAGCTGAGGCATCACCTAGATGCATTGGGTGGCTTGGC
AGCTGGCTGCGAGCAGCTGAAGAAGCAAACGGATCTGATACTTGTTCCCT
CGTCTGAAGATCCCACGGCACCTAATATTCTGCCTCGTGCTCCAATTCCC
GAATGCCTGGCAGCCGGGCTGCTAAAGGCCTGGCCACGCACCCAGTTGGC
TACGAATCCGTGTCGCCTACAGTACTGCACCCAGCAGATTGTGGTCTGCC
GTCTGGATTTAATGGCCAAGTTTTGTCGCAACACCTTGCATTTTCCCGAA
GATACGTCCCAGATCGAGCAGCATTTTGCCAGAACGATTGTGTGCCAGGG
TCATTTGGTGCCCATTCATCCGATTGCCATGCCAGTGCACTGGGACTACG
ATCCTGCTTTGTGGTTGTATCCACTGCCGGATCTTATTGTCATGGGCGAT
TCGTGCCAGAGCTTTAGCAGCAGTCAACATGGCTGCACTGTTCTCAATAC
CGGCTCCTTTGTCAAGTCCAAGTTCGCATTCAAAGTGTATATACCAGCGA
CGCGAACGATTGAGGACTCGGAAATACCGGACGAATTGGAGGCAAGCTTT
CTAGACCAT

BO27792.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
DNApol-epsilon58-RA 1578 CG10489-PA 1..1575 17..1591 7395 98 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
DNApol-epsilon58-RA 1688 CG10489-RA 57..1631 17..1591 7395 98 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5895748..5896617 1591..722 4080 97.9 Minus
3L 28110227 3L 5896674..5897379 722..17 3320 98 Minus
Blast to na_te.dros performed on 2014-11-26 15:02:43 has no hits.

BO27792.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-15 09:23:01 Download gff for BO27792.complete
Subject Subject Range Query Range Percent Splice Strand
Pole2-RA 1..1575 17..1593 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:28:21 Download gff for BO27792.complete
Subject Subject Range Query Range Percent Splice Strand
Pole2-RA 57..1631 17..1593 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:16 Download gff for BO27792.complete
Subject Subject Range Query Range Percent Splice Strand
DNApol-epsilon58-RA 57..1631 17..1593 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:05:16 Download gff for BO27792.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5896674..5897379 17..722 98   Minus
3L 5895746..5896616 723..1593 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:28:21 Download gff for BO27792.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5889774..5890479 17..722 98   Minus
arm_3L 5888846..5889716 723..1593 97 <- Minus

BO27792.pep Sequence

Translation from 16 to 1609

> BO27792.pep
MDVDLLPLRKRITNTFKLCGFLIRSENSSYLAEQLLPFDAAERDKWLTVI
TENLQSQKLLTPHVERAALEKAINELNRVGLDEGETVFALIDAFTVPRFR
YNQRIKKFELDTQPRQLLTAPRMKSDYMQQRYAMLLQKTLRHDLFAPAVI
QDGVGAEAQAKKFKLQFAENLLATSAMKEAVVLGLLTQLKEGKFYVEDPT
GCVQLDLTGARFHAGFFCEGCFVLAEGNYNNGVLKVDGLGFPPAEPANSS
RAFFGTANTWGGESAKLLKYSAGLQELERTNTETTIVFLSDVRLDLPVVM
EKLRQLFVGYDSCPPQAIVLMGPFTASTRNHHELRHHLDALGGLAAGCEQ
LKKQTDLILVPSSEDPTAPNILPRAPIPECLAAGLLKAWPRTQLATNPCR
LQYCTQQIVVCRLDLMAKFCRNTLHFPEDTSQIEQHFARTIVCQGHLVPI
HPIAMPVHWDYDPALWLYPLPDLIVMGDSCQSFSSSQHGCTVLNTGSFVK
SKFAFKVYIPATRTIEDSEIPDELEASFLDH

BO27792.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
DNApol-epsilon58-PA 525 CG10489-PA 1..525 1..525 2751 100 Plus