Clone BO27816 Report

Search the DGRC for BO27816

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:278
Well:16
Vector:pDNR-Dual
Associated Gene/TranscriptSam-S-RG
Protein status:BO27816.pep: Imported from assembly
Sequenced Size:1177

Clone Sequence Records

BO27816.complete Sequence

1177 bp assembled on 2010-10-13

GenBank Submission: KX794834

> BO27816.complete
GAAGTTATCAGTCGACATGATAAGCGCCGAGTGCCATTCAGAAGAATACA
CCCCAAATGACAAAATGTGCGACCAAATCAGCGACGCTATCTTGGATGCC
CATCTGAAGCAGGATCCAAACGCGAAGGTGGCGTGTGAAACCGTCGCCAA
GACGGGCATGATTCTGCTGTGCGGCGAGATCACGTCTAAGGCTGTGGTCG
ACTACCAGAAGGTTGTTCGTGAGACAGTGCAGCACATTGGTTATGATGAC
TCCTCCAAGGGTTTCGATTGGAAGACACTTAACCTGCTTGTAGCCATCGA
GCAACAGTCGCCCAACATTGCCAACGGCGTTCATATCAACCGCGAAGAAG
AAGACGTCGGCGCTGGTGACCAGGGTATCATGTTTGGATATGCCACCGAC
GAAACCGAGGAATGTATGCCCCTAACCGTCGTTTTGGCTCACAAACTAAA
CGAAAAGATTGCTGAGCTGCGTCGCTCAGATGTGTTCTGGTGGGCTCGCC
CCGATTCCAAAACACAAGTAACCTGCGAGTACCTCTTCAATCAGGGATCA
GCAGTTCCCAAGCGTGTCCACACTATTGTAGTGTCCATGCAGCATTCTGA
AAAGATATCGTTAGAAACCCTGCGCTCGGAAGTAATGGAGAAAGTTGTTA
AAGTAGTCATTCCCGCCAAATACATTGATGCCAACACCATTGTCCACATC
AATCCTTGTGGGCTTTTTGTAATCGGTGGACCAATGGGTGACGCTGGGCT
TACAGGAAGAAAAATCATTGTAGATACTTACGGAGGCTGGGGCGCCCACG
GCGGCGGTGCATTCTCTGGCAAGGACTTCACCAAGGTTGACAGATCAGCT
GCATATGCAGCACGCTGGGTGGCCAAATCACTGGTTAAGGCCGGTCTCTG
CAAGCGCTGCCTTGTCCAAGTGTCCTACGCCATAGGTCTTGCTGAGCCTC
TCTCCATAACTGTGTTCGACTACGGAACTTCTCACAAGTCACAAAAAGAA
CTTCTGGATATCATCCGTCGAAACTTTGACCTCAGGCCCGGCAAGATTGT
CAAGGACCTAAACCTGCGCCAGCCGATATACCAGCGAACAAGCACTTATG
GACACTTCGGTCGCGCGGGCTTCTCGTGGGAGGAGGCCAAGCCTCTGGAG
ATTGACAACGCAAGCTTTCTAGACCAT

BO27816.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Sam-S-RG 1146 CG2674-PG 1..1143 17..1159 5715 100 Plus
Sam-S-RJ 1227 CG2674-PJ 124..1224 59..1159 5505 100 Plus
Sam-S-RC 1227 CG2674-PC 124..1224 59..1159 5505 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Sam-S-RG 1971 CG2674-RG 158..1300 17..1159 5715 100 Plus
Sam-S-RJ 2309 CG2674-RJ 316..1416 59..1159 5505 100 Plus
Sam-S-RC 2380 CG2674-RC 387..1487 59..1159 5505 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 112687..113370 371..1054 3420 100 Plus
2L 23513712 2L 110754..110879 137..262 630 100 Plus
2L 23513712 2L 111004..111118 260..374 575 100 Plus
2L 23513712 2L 113434..113539 1054..1159 530 100 Plus
2L 23513712 2L 110405..110483 59..137 395 100 Plus
2L 23513712 2L 109751..109793 17..59 215 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:59:22 has no hits.

BO27816.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-13 16:19:24 Download gff for BO27816.complete
Subject Subject Range Query Range Percent Splice Strand
M(2)21AB-RG 144..1286 17..1161 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:27:58 Download gff for BO27816.complete
Subject Subject Range Query Range Percent Splice Strand
Sam-S-RG 158..1300 17..1161 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:04:11 Download gff for BO27816.complete
Subject Subject Range Query Range Percent Splice Strand
Sam-S-RG 158..1300 17..1161 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:11 Download gff for BO27816.complete
Subject Subject Range Query Range Percent Splice Strand
2L 113434..113539 1054..1161 98   Plus
2L 112690..113369 374..1053 100 -> Plus
2L 111005..111117 261..373 100 -> Plus
2L 110755..110877 138..260 100 -> Plus
2L 110406..110483 60..137 100 -> Plus
2L 109751..109793 17..59 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:27:58 Download gff for BO27816.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 113434..113539 1054..1161 98   Plus
arm_2L 112690..113369 374..1053 100 -> Plus
arm_2L 111005..111117 261..373 100 -> Plus
arm_2L 110755..110877 138..260 100 -> Plus
arm_2L 110406..110483 60..137 100 -> Plus
arm_2L 109751..109793 17..59 100 -> Plus

BO27816.pep Sequence

Translation from 16 to 1177

> BO27816.pep
MISAECHSEEYTPNDKMCDQISDAILDAHLKQDPNAKVACETVAKTGMIL
LCGEITSKAVVDYQKVVRETVQHIGYDDSSKGFDWKTLNLLVAIEQQSPN
IANGVHINREEEDVGAGDQGIMFGYATDETEECMPLTVVLAHKLNEKIAE
LRRSDVFWWARPDSKTQVTCEYLFNQGSAVPKRVHTIVVSMQHSEKISLE
TLRSEVMEKVVKVVIPAKYIDANTIVHINPCGLFVIGGPMGDAGLTGRKI
IVDTYGGWGAHGGGAFSGKDFTKVDRSAAYAARWVAKSLVKAGLCKRCLV
QVSYAIGLAEPLSITVFDYGTSHKSQKELLDIIRRNFDLRPGKIVKDLNL
RQPIYQRTSTYGHFGRAGFSWEEAKPLEIDNASFLDH

BO27816.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Sam-S-PG 381 CG2674-PG 1..381 1..381 1998 100 Plus
Sam-S-PJ 408 CG2674-PJ 42..408 15..381 1920 100 Plus
Sam-S-PC 408 CG2674-PC 42..408 15..381 1920 100 Plus
Sam-S-PE 408 CG2674-PE 42..408 15..381 1868 96.7 Plus
Sam-S-PA 408 CG2674-PA 42..408 15..381 1868 96.7 Plus