Clone BO27833 Report

Search the DGRC for BO27833

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:278
Well:33
Vector:pDNR-Dual
Associated Gene/Transcriptine-RA
Protein status:BO27833.pep: Imported from assembly
Sequenced Size:2008

Clone Sequence Records

BO27833.complete Sequence

2008 bp assembled on 2010-10-20

GenBank Submission: KX798345

> BO27833.complete
GAAGTTATCAGTCGACATGCCGAACCGCCAGGACTACGATGCACAGTCCT
CGAAGCACTCGGAACAGTCCTTCTTCCGCTTCAACCGGGTGGCCAAAGTA
CCCCTGGGGGTGGATGACGATGACAGCTACCTGGACATGTCCGATGAGAC
GGCCCAGCTCAAGCCGCGCCAGCAGCACTGGGCCAATAAGATGCAATTCG
TCCTGGCCTGCATAGGATACTCGGTGGGTCTGGGCAACGTCTGGCGTTTT
CCGTACATGTGCTACAAGAGTGGCGGTGGTGTTTTTCTAGTACCTTATTG
CATAATACTGTTCATATGCAGCATTCCGCTGCTCTTCATGGAGCTGTCCG
TTGGCCAATACACCGGTCGAGGACCCATTGGAGCACTGGGTCAACTGTGT
CCTCTGTTCAAGGGAGCCGGACTCGCCAGCGTGGTCGTCTCGTTCCTCAT
GTCCACCTACTATAGTGTCATCATAGGCTACTCCATCTACTACTTCTTTA
CGTCGTTCAAAACGGAAATGCCCTGGATCGACTGCAACAACAGGTGGAAC
ACGCCCGATTGCTGGGTGCCACAGCGCAAGGGGATTAATGCCAGTGCGCC
GGACACATCTCGCACTCCATCCGAGGAATTCTTCGAAAACAAGGTCCTGC
AGATCAGCGGTGGCCTGGAGTATCCGGGCATGATGCGCTGGGAGCTATTT
GCCTGCCTGATCTGCGCCTGGCTAATGGTCTACTTCGCCACGTGGAAGTC
GATCAAGTCGTCGGCGAAGGTGCGCTACTTCACGGCCACGTTTCCGTTCG
TGCTGATCATCATCCTGATGGTGCGCGCGGTGACCCTGGATGGAGCTGCT
GAGGGTTTGCGCTTCTTCTTCCGTCCCAAGTGGTCGGAGCTGAAGAACGC
CAATGTGTGGATCAACGCCGCATCCCAGAACTTCAACTCGCTGGGCATTA
CATTCGGATCCATGATCTCCTTTGCCAGCTACAACAAGTACAACAACAAT
ATCCTGCGAGATACCGTGGCAGTGAGTGCGGTGAATATGATCACCAGTCT
CCTGGTGGGCATCTTTGCCTTCTCCACGCTGGGCAATCTGGCGCTGGAGC
AGAACACCAATGTGAGGGACGTCATCGGTGATGGACCGGGCATGATATTC
GTGGTGTATCCCCAGGCGATGGCTAAGATGCCGTACGCTCAGCTCTGGGC
GGTCATGTTCTTCTTCATGCTGCTCTGCCTAGGTCTGAACTCGCAGTTTG
CCATTGTGGAGGTTGTGGTCACGTCCATACAGGATGGCTTTCCGCGGTGG
ATCAAGCGGCACCTGGGCTATCACGAAATCGTGGTCCTGTTCGTCTGTGT
CATCTCATGTCTCTTCGGGATGCCCAACATCATACAGGGTGGCATCTACT
ACTTCCAGCTAATGGATCACTACGCCGCCTCCGTGACGATCATGTTTCTG
GCCTTCTGTCAAATGATTGCCATTGCCTGGTTCTACGGCACGGGAAGACT
GTCGAAGAACGTCAAGCAAATGACCGGAAAGGCGCCTTCGTTCTATCTCA
GATCCTGCTGGCTAGTCCTGGGACCCTGCCTCCTCTTTGCCATCTGGGTA
TTGAGTCTGATCAACTACCACGAGCCCACCTACCACAATGGACGCTATAC
CTATCCGGACTGGGCCTACGGAATAGGCTGGATGTTCGCTTCATTCTCGC
TGATCTGCATACCTGGATATGCGGTTATCAACTTCCTGCGCTCCAGTGGA
GATACCTTTTGGGAACGCATCCGGAACACGCTGAGACCCAACATCTACGA
GTGCAAGATTTGCGGGGAACACCACTGCGAACACGACTATCCGGAGCAGG
AGCAGTTTATGCTGGCCCAGGAAATGGCCACAGTGTACAAGCCCACCAAC
CCACACCTGCTCAATCTCGGCCAGAAGTGCGGCTACAACGCCATGCAAGC
CTCACCCTCACATGCGGAGGCAGGAGGACCATGTGGCCAGGCAAGCTTTC
TAGACCAT

BO27833.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
ine-RA 1977 CG15444-PA 1..1974 17..1990 9870 100 Plus
ine-RF 2832 CG15444-PF 939..2829 100..1990 9455 100 Plus
ine-RE 2832 CG15444-PE 939..2829 100..1990 9455 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
ine-RA 2272 CG15444-RA 156..2135 11..1990 9885 99.9 Plus
ine-RF 3436 CG15444-RF 1439..3329 100..1990 9455 100 Plus
ine-RE 3458 CG15444-RE 1461..3351 100..1990 9455 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4468666..4469618 1589..637 4765 100 Minus
2L 23513712 2L 4468137..4468361 1990..1766 1125 100 Minus
2L 23513712 2L 4471978..4472158 280..100 905 100 Minus
2L 23513712 2L 4468425..4468601 1765..1589 885 100 Minus
2L 23513712 2L 4470993..4471129 414..278 685 100 Minus
2L 23513712 2L 4469832..4469966 547..413 675 100 Minus
2L 23513712 2L 4469675..4469770 636..541 480 100 Minus
2L 23513712 2L 4472949..4473037 99..11 430 98.9 Minus
2R 25286936 2R 24407017..24407126 999..890 190 78.2 Minus
Blast to na_te.dros performed on 2014-11-26 15:06:57 has no hits.

BO27833.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-20 10:47:31 Download gff for BO27833.complete
Subject Subject Range Query Range Percent Splice Strand
ine-RA 160..2133 17..1992 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:29:08 Download gff for BO27833.complete
Subject Subject Range Query Range Percent Splice Strand
ine-RA 162..2135 17..1992 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:06:45 Download gff for BO27833.complete
Subject Subject Range Query Range Percent Splice Strand
ine-RA 162..2135 17..1992 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:06:45 Download gff for BO27833.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4472949..4473031 17..99 100   Minus
2L 4471980..4472158 100..278 100 <- Minus
2L 4470994..4471128 279..413 100 <- Minus
2L 4469836..4469965 414..543 100 <- Minus
2L 4469675..4469767 544..636 100 <- Minus
2L 4468667..4469618 637..1588 100 <- Minus
2L 4468425..4468601 1589..1765 100 <- Minus
2L 4468133..4468361 1766..1992 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:29:08 Download gff for BO27833.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4472949..4473031 17..99 100   Minus
arm_2L 4471980..4472158 100..278 100 <- Minus
arm_2L 4470994..4471128 279..413 100 <- Minus
arm_2L 4469836..4469965 414..543 100 <- Minus
arm_2L 4469675..4469767 544..636 100 <- Minus
arm_2L 4468667..4469618 637..1588 100 <- Minus
arm_2L 4468425..4468601 1589..1765 100 <- Minus
arm_2L 4468133..4468361 1766..1992 99 <- Minus

BO27833.pep Sequence

Translation from 16 to 2008

> BO27833.pep
MPNRQDYDAQSSKHSEQSFFRFNRVAKVPLGVDDDDSYLDMSDETAQLKP
RQQHWANKMQFVLACIGYSVGLGNVWRFPYMCYKSGGGVFLVPYCIILFI
CSIPLLFMELSVGQYTGRGPIGALGQLCPLFKGAGLASVVVSFLMSTYYS
VIIGYSIYYFFTSFKTEMPWIDCNNRWNTPDCWVPQRKGINASAPDTSRT
PSEEFFENKVLQISGGLEYPGMMRWELFACLICAWLMVYFATWKSIKSSA
KVRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRPKWSELKNANVWIN
AASQNFNSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVGIF
AFSTLGNLALEQNTNVRDVIGDGPGMIFVVYPQAMAKMPYAQLWAVMFFF
MLLCLGLNSQFAIVEVVVTSIQDGFPRWIKRHLGYHEIVVLFVCVISCLF
GMPNIIQGGIYYFQLMDHYAASVTIMFLAFCQMIAIAWFYGTGRLSKNVK
QMTGKAPSFYLRSCWLVLGPCLLFAIWVLSLINYHEPTYHNGRYTYPDWA
YGIGWMFASFSLICIPGYAVINFLRSSGDTFWERIRNTLRPNIYECKICG
EHHCEHDYPEQEQFMLAQEMATVYKPTNPHLLNLGQKCGYNAMQASPSHA
EAGGPCGQASFLDH

BO27833.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
ine-PA 658 CG15444-PA 1..658 1..658 3562 100 Plus
ine-PF 943 CG15444-PF 300..943 15..658 3417 98.1 Plus
ine-PE 943 CG15444-PE 300..943 15..658 3417 98.1 Plus
ine-PB 943 CG15444-PB 300..943 15..658 3417 98.1 Plus
ine-PC 943 CG15444-PC 300..943 15..658 3417 98.1 Plus