Clone BO27938 Report

Search the DGRC for BO27938

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:279
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCG15269-RA
Protein status:BO27938.pep: Imported from assembly
Sequenced Size:1795

Clone Sequence Records

BO27938.complete Sequence

1795 bp assembled on 2011-07-18

GenBank Submission: KX798846

> BO27938.complete
GAAGTTATCAGTCGACATGCTGCAGCGCAGTTACGACCTTTCGCCCTCGC
CGGCGCGTACTTCACCCACCAATGGAGTCCAGAACTTGGGAGCTGGGGCA
CAGTTGCCACCGGCTCAAGTCACTGACTTTAGCATCAGTAAGATTCTGGG
CAAGGAGCGTAAATCCGCTCAGGATACGAGCACGAATATCCTGGATCTAT
CCAAGAGCAGTAGCAACAGTATTAGGAGCCCACAGGCTCTTGGAGGGCTG
GCAATACCATCAACTCCTTATGCCTCCGGTGCCTACTCCATGTTGCCGCC
AGATTTGGTGGCCATGGCCAATGCCACCAAGTTCTATGCCCAATTCTTCC
CGCACTTACTGCCCGCCTATGCGGCTGCTGCAGCGGCTGCCGGCTTGAGT
ACTCCTCCTACGTCGCCCTATCAAACACATCAGCATCAGCAGCATTTGCC
AAATCAGCAGAAACGCTTCTTTGCTCCCTATGTGATCAATGGATCGGTTC
CCCCACCACCACCACTGCAGCAGCAACAGCAACCTCTCATACGCACCAAA
AGCACCGCATGCACTCGTCCGGATTGCCCGGAGTGCCTGGATTATTACCA
AAGATTGCAGACTGGTGGCTATAAGCAGACCGCACCTCTCATCTCACCCG
CCGCCTCCTCGGTGAGCAGTTCCACCGGATCAATACGTCCTGTGAGGGAT
CTGATTATGAGTGCCACTGGAGGAGCCGCCAGCACTAACATCTCACTGAC
CACCGTGACCAATCTGAGTCTGAACTCGGTCCAGGCAACGGCCGTCGGAA
TGATGCCCAAGATGACCGGTGGACTGATCACCACAGCCGTCGGCAGCAAC
AGTGGAGCAATCGGTGGTATCGGTGGATACAATGCCACATCCGCCGAGGA
GATCAGCTACAAGTGCCGGATTTGCGAGAAGGTATTCGGATGCTCTGAAA
CTCTGCAGGCTCATGAAAAGACGCACAAATCGCCGCGTTACGAGTGTGCG
GATTGTGGAAAGGGTTTCTCCCAGCTGCGAAATTACAAATATCACCTGTC
CGTTCACCGAGGAACCAAGGAGTTTGCCGCCGAGTGTCCCGAATGTGGCA
AGACATTCAACGATAAGGGATATTTGAGCAGTCACCTAAAGATTCACCGG
AACCGGAAGGAGTACGAGTGTCCTTACTGTCCCAAATCGTTCAATCAGCG
TGTGGCCTTCAATATGCATGTCCGGATTCATACCGGCGTGAAACCCCACA
AATGCAACGAGTGCGGAAAGAGATTTTCGCGTAAAATGCTGCTCAAACAG
CACATGAGGACGCACAGTGGTGAGAAACCGTATCAGTGCTCCGTGTGCGG
CAAGTCCTTTGCCGATCGCAGCAACATGACCCTGCACCATCGCCTCCACT
CGGGAATCAAGCCCTTCAGCTGCCCCCTGTGCCCCAAAGCCTTCACCAAA
AAGCATCACCTAAAGACGCATCTGAATTACCATACAGGCTGCAAGCCGTA
TGTCTGCCCACATCCCAACTGCAATCAGGCATTCACCCAGTCGAGCAATA
TGCGAACCCACGCTAAGAAGTGTCAGTACCGTCCGTTGGATGGACTCACG
GTCACATCATCCGCACTTCCAGTACCGGGAAAACAACAAACAGGTCCACC
GCCCACTTTGGCCATGGCCATGGCTCAAACATTTCAAATGCCGCCACCTC
CTGGAGTTCTAACACCTGGATCTGGTCCATCCCAACCGCCGAGTCAGCAA
ACCCTTCTCAGCAATCTCAGGACATTCGCAAGCTTTCTAGACCAT

BO27938.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15269-RA 1764 CG15269-PA 1..1761 17..1777 8805 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG15269-RA 2122 CG15269-RA 180..1941 16..1777 8810 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15109584..15110527 16..959 4720 100 Plus
2L 23513712 2L 15112090..15112911 956..1777 4110 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:35:18 has no hits.

BO27938.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:38 Download gff for BO27938.complete
Subject Subject Range Query Range Percent Splice Strand
CG15269-RA 1..1761 17..1779 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:30:59 Download gff for BO27938.complete
Subject Subject Range Query Range Percent Splice Strand
CG15269-RA 181..1941 17..1779 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:13 Download gff for BO27938.complete
Subject Subject Range Query Range Percent Splice Strand
CG15269-RA 181..1941 17..1779 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:13 Download gff for BO27938.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15112093..15112911 959..1779 99   Plus
2L 15109585..15110526 17..958 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:30:59 Download gff for BO27938.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15112093..15112911 959..1779 99   Plus
arm_2L 15109585..15110526 17..958 100 -> Plus

BO27938.pep Sequence

Translation from 16 to 1795

> BO27938.pep
MLQRSYDLSPSPARTSPTNGVQNLGAGAQLPPAQVTDFSISKILGKERKS
AQDTSTNILDLSKSSSNSIRSPQALGGLAIPSTPYASGAYSMLPPDLVAM
ANATKFYAQFFPHLLPAYAAAAAAAGLSTPPTSPYQTHQHQQHLPNQQKR
FFAPYVINGSVPPPPPLQQQQQPLIRTKSTACTRPDCPECLDYYQRLQTG
GYKQTAPLISPAASSVSSSTGSIRPVRDLIMSATGGAASTNISLTTVTNL
SLNSVQATAVGMMPKMTGGLITTAVGSNSGAIGGIGGYNATSAEEISYKC
RICEKVFGCSETLQAHEKTHKSPRYECADCGKGFSQLRNYKYHLSVHRGT
KEFAAECPECGKTFNDKGYLSSHLKIHRNRKEYECPYCPKSFNQRVAFNM
HVRIHTGVKPHKCNECGKRFSRKMLLKQHMRTHSGEKPYQCSVCGKSFAD
RSNMTLHHRLHSGIKPFSCPLCPKAFTKKHHLKTHLNYHTGCKPYVCPHP
NCNQAFTQSSNMRTHAKKCQYRPLDGLTVTSSALPVPGKQQTGPPPTLAM
AMAQTFQMPPPPGVLTPGSGPSQPPSQQTLLSNLRTFASFLDH

BO27938.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG15269-PA 587 CG15269-PA 1..587 1..587 3153 100 Plus
crol-PC 756 CG14938-PC 85..429 200..519 483 30.7 Plus
crol-PH 686 CG14938-PH 85..430 200..519 476 30.4 Plus
crol-PG 878 CG14938-PG 86..466 159..518 476 29.7 Plus
Meics-PB 571 CG8474-PB 262..474 300..515 459 37.8 Plus
crol-PG 878 CG14938-PG 330..551 295..519 439 35.8 Plus
crol-PC 756 CG14938-PC 292..516 295..517 421 36.1 Plus
crol-PG 878 CG14938-PG 414..638 295..517 421 36.1 Plus
crol-PH 686 CG14938-PH 265..471 295..497 371 35.9 Plus
crol-PH 686 CG14938-PH 293..488 295..484 349 36.2 Plus
crol-PC 756 CG14938-PC 320..518 295..461 255 29.9 Plus
crol-PG 878 CG14938-PG 442..640 295..461 255 29.9 Plus