Clone BO28107 Report

Search the DGRC for BO28107

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:7
Vector:pDNR-Dual
Associated Gene/Transcriptyellow-g2-RA
Protein status:BO28107.pep: Imported from assembly
Sequenced Size:1180

Clone Sequence Records

BO28107.complete Sequence

1180 bp assembled on 2011-09-14

GenBank Submission: KX796626

> BO28107.complete
GAAGTTATCAGTCGACATGAGACTGCACTTGGCCCTGATCCTTGGATTTT
GCCTAGTTGGCTGGGCCCGCTCGCAGGGCACCAAGTACGGACTGTGGACT
CCGGATCGGGCGCACTCCGATTCTCAGCCCATCCAGTGGACGGGCGGGCA
ATTCGAGTTCCCATGCGCCAGTACCAAGTCGCTCTTCAAGAGCTCCGGAA
AGTTTATACCCAAGAATGTGATTGCCACGCGGGCGCAGCTCATTGGAGAC
ACCATCTATCTGGCTCTGCCGCGCTACAGGAAGGGAGTTCCGGCCACGCT
GGTGAAGACCAGTATCAAGCCGGGCACCTGCTCCACCACCTTTAAGCCCT
ATCCCTGCTGGGACCTCCAGGAGGAGGGCAACTGCAAGGCTCTGCAATCG
GTGGTGGATCTGGTGGTAGACCAAAACGAGGTGCTCTGGGTCTTGGACAC
GGGCATAGTGAACACTCTGGAGACTCCGGTGCGCAAGTGCCCACCAAAAG
TGGTGGCCATGTCGGTGAAGACTGGCAAGGTTCTGAAGACCGTCTCGCTG
GAGGGCCTGACTTCCAGCAATTCCCGTCTCCAATATCTGGTAGTGGACTA
TGCTCCGGATGGCGGCTGCTTTGTCTACGTCAGCGATGCCGCCAATCGGG
CCATCATCGTGTACAATCTCCAGGCGGATCGGGGATTCAGGGTGGTGCTG
CCCAAGGCCGTTACCGCCGGCTGTCGGTCGAGGGATGTCCTCTACATAGC
CCTCATCCGCCGGGACTGCGGCTCAACGGAACTGTACTTCACCTACCTGA
GCACCAACAAACTGTTCTCCCTGAAGTCAGAGTATCTGAGGAGTGGAGTG
GCCGATGGACGCATCTTGGATCTCGGCAAGAAGCCCAGTCGCATGGTCAT
CATCGGCACGGACAACGGCTCGGCGATCTTCTTCCGCAACGAGGGCGACG
CGGAGGTGTACCGCTGGGACACGAACTCCACATTCGTGGAGGCCAACTTC
AAGCCGGTTTACCGCAGTCAGACCTGCCAGCTGGTGACCCATGCTGTGCC
CGATTACAAGCGGAACACGATGCGAGTCCTGCAGAGCAATTTTCCGGATT
ACATGCAGAACCGCGTTGGATGCGGAGCCATTCAGCAGCTGGGTCTGATG
CAGGGCTGTTGGGCAAGCTTTCTAGACCAT

BO28107.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-g2-RA 1149 CG13804-PA 1..1146 17..1162 5730 100 Plus
yellow-g-RA 1182 CG5717-PA 361..486 347..472 210 77.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-g2-RA 1431 CG13804-RA 49..1194 17..1162 5730 100 Plus
yellow-g-RA 1344 CG5717-RA 439..564 347..472 210 77.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:11:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2276598..2277450 17..869 4265 100 Plus
3L 28110227 3L 2277508..2277801 869..1162 1470 100 Plus
3L 28110227 3L 2272270..2272331 408..347 190 87.1 Minus
Blast to na_te.dros performed on 2014-11-27 07:11:24 has no hits.

BO28107.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-09-14 11:59:05 Download gff for BO28107.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-g2-RA 49..1194 17..1164 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:08:09 Download gff for BO28107.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-g2-RA 49..1194 17..1164 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:05:17 Download gff for BO28107.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-g2-RA 49..1194 17..1164 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:05:17 Download gff for BO28107.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2277509..2277801 870..1164 99   Plus
3L 2276598..2277450 17..869 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:08:09 Download gff for BO28107.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2277509..2277801 870..1164 99   Plus
arm_3L 2276598..2277450 17..869 100 -> Plus

BO28107.pep Sequence

Translation from 16 to 1180

> BO28107.pep
MRLHLALILGFCLVGWARSQGTKYGLWTPDRAHSDSQPIQWTGGQFEFPC
ASTKSLFKSSGKFIPKNVIATRAQLIGDTIYLALPRYRKGVPATLVKTSI
KPGTCSTTFKPYPCWDLQEEGNCKALQSVVDLVVDQNEVLWVLDTGIVNT
LETPVRKCPPKVVAMSVKTGKVLKTVSLEGLTSSNSRLQYLVVDYAPDGG
CFVYVSDAANRAIIVYNLQADRGFRVVLPKAVTAGCRSRDVLYIALIRRD
CGSTELYFTYLSTNKLFSLKSEYLRSGVADGRILDLGKKPSRMVIIGTDN
GSAIFFRNEGDAEVYRWDTNSTFVEANFKPVYRSQTCQLVTHAVPDYKRN
TMRVLQSNFPDYMQNRVGCGAIQQLGLMQGCWASFLDH

BO28107.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-g2-PA 382 CG13804-PA 1..382 1..382 2016 100 Plus
yellow-g-PA 393 CG5717-PA 50..377 40..369 880 48.8 Plus
yellow-e-PA 530 CG9792-PA 52..329 65..318 240 29.1 Plus
yellow-h-PA 463 CG1629-PA 78..249 60..226 229 31.4 Plus
y-PA 541 CG3757-PA 22..284 32..275 221 25 Plus