Clone BO28130 Report

Search the DGRC for BO28130

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptCG3640-RA
Protein status:BO28130.pep: Imported from assembly
Sequenced Size:922

Clone Sequence Records

BO28130.complete Sequence

922 bp assembled on 2011-07-18

GenBank Submission: KX795832

> BO28130.complete
GAAGTTATCAGTCGACATGTTTTCGATCAGAGTGTGGTTCATCTGCCTGG
TGATAGTTACCCTCAACTCCTTTCCCGCCTACTCCTGGGATTATTGCCAA
GAGCACTGGTGTCCGCGTTCCACCGACCACGTAGCGTGCAACAACAACGG
GACGTTTGGCCTCGATTGCGGAAGGGAGGCCAGGCTAATCCCGCTCAGCA
ATCAGTTGCAGGCGTTCATTGTGCACCAGGTAAACTTCTATCGCAACCAG
GTGGCTTCGGGCGGACTCTCCGCCTTCGGACCCGCCCGCCGAATGGCTAG
TGTCCGCTGGGATCCCGAGCTGGCACAGCTGGCTGAGCTGGCGGCAAAGA
GGTGCAGTTTGTCCGGCGATGGATGCCGCAACACCAGGCGATTCAAGCAC
GTGGGCCAGCTGACGGGCCACGTAATCTTCAGTGCGGGAAAGCACAGCGA
CTTGGAGCTGCTGCGCCACAAGATCTCGAATTGGTTTGGCCAGTACATGA
GAGCCAGCAAGGATCTGCAAGCCGCCGATCCATCAAGCAACATCAGCAGC
TTCCGGCAGTTGATACAGGAAAGCTCCACCCACATGGGATGCGGCGTGCT
CCGCCAGAGGAGCCACATGCTGTGGCACCAGCAGTTCATCGTCTGTAACT
TTGCCCGTAGGAATATGCCCCGCGAGCAGGTCTACCAGGTGGGCGTGGCT
GCCACAGGATGCAGGTCGGGAAGGAATCCTCGCTATCCCAATCTCTGCGC
TCTGCAGGAAGAATACGATGTGAACGCCGTCGACCGTTTTCACTCAAAGC
GGCCACTTAGGATAAGGTTCAAGTACAGCGCATCCCATCCATCGAAAGTT
TTGGGTGCTGATCGTGATGTAGCCTTCCATCCCAATATCAAGTTGGGACG
TCTTGCAAGCTTTCTAGACCAT

BO28130.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:36:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG3640-RA 891 CG3640-PA 1..888 17..904 4440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:36:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG3640-RA 994 CG3640-RA 9..896 17..904 4440 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24639905..24640658 151..904 3770 100 Plus
2R 25286936 2R 24639696..24639830 17..151 675 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:36:33 has no hits.

BO28130.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:41 Download gff for BO28130.complete
Subject Subject Range Query Range Percent Splice Strand
CG3640-RA 16..896 24..906 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:26 Download gff for BO28130.complete
Subject Subject Range Query Range Percent Splice Strand
CG3640-RA 16..896 24..906 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:42 Download gff for BO28130.complete
Subject Subject Range Query Range Percent Splice Strand
CG3640-RA 16..896 24..906 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:42 Download gff for BO28130.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24639906..24640658 152..906 99   Plus
2R 24639703..24639830 24..151 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:26 Download gff for BO28130.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20527429..20528181 152..906 99   Plus
arm_2R 20527226..20527353 24..151 100 -> Plus

BO28130.pep Sequence

Translation from 16 to 922

> BO28130.pep
MFSIRVWFICLVIVTLNSFPAYSWDYCQEHWCPRSTDHVACNNNGTFGLD
CGREARLIPLSNQLQAFIVHQVNFYRNQVASGGLSAFGPARRMASVRWDP
ELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFSAGKHSDLELLR
HKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVLRQRSH
MLWHQQFIVCNFARRNMPREQVYQVGVAATGCRSGRNPRYPNLCALQEEY
DVNAVDRFHSKRPLRIRFKYSASHPSKVLGADRDVAFHPNIKLGRLASFL
DH

BO28130.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG3640-PA 296 CG3640-PA 1..296 1..296 1596 100 Plus
CG17575-PA 291 CG17575-PA 6..283 7..251 427 34.2 Plus
CG17575-PB 298 CG17575-PB 6..290 7..251 420 33.3 Plus
CG42564-PA 500 CG10284-PA 54..284 25..251 357 34.7 Plus
CG9822-PA 263 CG9822-PA 13..259 11..253 345 33.2 Plus