Clone BO28132 Report

Search the DGRC for BO28132

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptCG5155-RA
Protein status:BO28132.pep: Imported from assembly
Sequenced Size:2041

Clone Sequence Records

BO28132.complete Sequence

2041 bp assembled on 2011-07-18

GenBank Submission: KX795810

> BO28132.complete
GAAGTTATCAGTCGACATGATTGGCACTAGCAGCGGAACGTCCCACAATC
GGAGTCGAAAGAAGAAAGAACAGTGCGGATCCTGTCCCAACAGATTCTCA
AAGGATAAGCGCCAGGTGGCCGCCGAGGACTCGGATACCACGGAGGTGGA
ATCGTCTACGGATGAGGAGGAACGCTGGAAGGAAGTGGCGCGAGCCGCTG
AGATTCCGGCTGACTATTATAATATCCAAAAACTGGTGAAATACATCAAG
GCGGGCAATCAGACAGCCACTATAGTATCGTTGTGCTGCTTGAAGGACTA
CGATCTGAGCACCCAGATCAATCAGTTCGCCATCTCGGACATCGGCGGAC
TCGATGTCTTGGTTAACATCCTGGAGTGCAGCGACACCAAGTGCTGTTTG
GGCGCCCTCAAAGTTCTCTCAGATATCACACTGAACATCGATATTAGGAA
GACCATCGTAGATCTGGATGGCATTCCCCTCATTGTGGACATCCTAAACT
CTTCCATGAAGGACCTAAAAACCATGGCCGCCGAGACATTGGCCAATGTG
TGCAAGGTGCGACTGGCCAGAAAGTATGTGCGCACCTGCGGAGGAATCCC
CAAGCTGGTGGATCTCATCGACATCAAGTTGAGCATTCTAAAGACGCCTC
GTGACCAATTGAGTCCAGATGATCTGGAATCTCTCGATATGACACGCGCT
GGAGCCCGGGCTCTTTTCACTCTGGCCGATTCCAAGCACAACATGGAGCA
GATGCGCAAGAGCGGAATTGTTCCTTTGATGGCTCAGCTCCTTAAGTCCT
GTCACATCGATGTCGTCATTCCCATAATGGGCACCGTTCGAAAGTGCTCC
TCGGAGCCGAAGTTCCAACTGGCCATCACCACCGAGGGCATGATTCCCGA
CATTGTGAGCCATCTGAGTTCCGAAAATACCGAGCTGAAGATGGAGGGCA
GTACAGCGATCTACAAGTGCGCCTTCGACGGAACCACCAGGGATTTGGTG
AGGGAGGCTGGGGGCTTGGAACCTTTGGTAACTATCATAAAGGACAAGAA
TGTGAGGGAAAATAAGCCTTTATTGAGAGGCGCCACTGGAGCGATTTGGA
TGTGTGCCGTAACCGATGCAAATGTCAAAGTGCTGGATCAACTCAGGACG
GTGAACCACCTGGTGGCCTTGCTAAATGATGAGTGTGACGAGGTCCTGAC
CAACGTGACCGGAGCTATATCTGAATGTGTGAGATTTCAAAGCAATAGGG
AGCAACTGCGTCAGGCTGGAGGATTACCAGCAATGGTTTCCCTACTCAAC
AGTTCTCACGCCCCTCTTCTGGAAAATTTAGCCAAGGGATTGAAGGAGTG
TGCCGAAGATCCGGACAGCATGAGAATCCTTGAGGATCTGGATGCGGTCA
GGCTGATATGGTCGCTATTGAAGAACCCCACAACTAGGGTTCAGGCCCAT
GCGGCTTACGCCATATGTCCCTGTGTTCGAAATGCCAACGATTCCGCTGA
ATTGGTCAGGAGCTTGGTTGGCGCCATGGAACTGGTGGTGGGTCTGCTAA
AGTCCAAGGATATCATGGTCTTATCCGCCGTTTGTGCTGCCATTGCAACA
ATTGCCCAGGATCAAACCAATCTAGCCATCTTAACCGATCTGAAAGTCAT
CTACAAGCTAGCCGATCTCGTCCAGACCACCGACGACCTCCTTCGAATGA
ACTTGGCAGCTGCCGTGGCCGCCTGTGCCTGCTTCGGTAATAATACGGAG
GAACTGGGACGTCTGCGTACTGTCACTCCGATTGTCACCTACATGACCAG
CGACAATCCCTTGGTGCACCGCAGCACGGCCATGGCACTGGAGAAGCTAT
CGATGGATCCGCAGAACTGCATTACCATGCACCAGAGTGGAGTTGTTCCT
TTCCTGCTGGAGTGCATTGGATCCACTAACAAGGAGCTCCAGTTGGCCGC
CGCTGGTTGTCTGCGCAATATCCGCGAATTGGCCTTGCGTGCCGAGGAAT
ATCTGCTTAAAATCGACGATGACGCAAGCTTTCTAGACCAT

BO28132.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
gudu-RA 2010 CG5155-PA 1..2007 17..2023 10035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
gudu-RA 2252 CG5155-RA 169..2175 17..2023 10035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7389373..7390626 632..1885 6270 100 Plus
2L 23513712 2L 7388676..7389292 17..633 3085 100 Plus
2L 23513712 2L 7390685..7390825 1883..2023 705 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:36:53 has no hits.

BO28132.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:41 Download gff for BO28132.complete
Subject Subject Range Query Range Percent Splice Strand
CG5155-RA 140..2146 17..2025 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:34 Download gff for BO28132.complete
Subject Subject Range Query Range Percent Splice Strand
CG5155-RA 169..2175 17..2025 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:50 Download gff for BO28132.complete
Subject Subject Range Query Range Percent Splice Strand
gudu-RA 169..2175 17..2025 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:50 Download gff for BO28132.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7390688..7390825 1886..2025 98   Plus
2L 7389375..7390626 634..1885 100 -> Plus
2L 7388676..7389292 17..633 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:34 Download gff for BO28132.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7390688..7390825 1886..2025 98   Plus
arm_2L 7389375..7390626 634..1885 100 -> Plus
arm_2L 7388676..7389292 17..633 100 -> Plus

BO28132.pep Sequence

Translation from 16 to 2041

> BO28132.pep
MIGTSSGTSHNRSRKKKEQCGSCPNRFSKDKRQVAAEDSDTTEVESSTDE
EERWKEVARAAEIPADYYNIQKLVKYIKAGNQTATIVSLCCLKDYDLSTQ
INQFAISDIGGLDVLVNILECSDTKCCLGALKVLSDITLNIDIRKTIVDL
DGIPLIVDILNSSMKDLKTMAAETLANVCKVRLARKYVRTCGGIPKLVDL
IDIKLSILKTPRDQLSPDDLESLDMTRAGARALFTLADSKHNMEQMRKSG
IVPLMAQLLKSCHIDVVIPIMGTVRKCSSEPKFQLAITTEGMIPDIVSHL
SSENTELKMEGSTAIYKCAFDGTTRDLVREAGGLEPLVTIIKDKNVRENK
PLLRGATGAIWMCAVTDANVKVLDQLRTVNHLVALLNDECDEVLTNVTGA
ISECVRFQSNREQLRQAGGLPAMVSLLNSSHAPLLENLAKGLKECAEDPD
SMRILEDLDAVRLIWSLLKNPTTRVQAHAAYAICPCVRNANDSAELVRSL
VGAMELVVGLLKSKDIMVLSAVCAAIATIAQDQTNLAILTDLKVIYKLAD
LVQTTDDLLRMNLAAAVAACACFGNNTEELGRLRTVTPIVTYMTSDNPLV
HRSTAMALEKLSMDPQNCITMHQSGVVPFLLECIGSTNKELQLAAAGCLR
NIRELALRAEEYLLKIDDDASFLDH

BO28132.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:35
Subject Length Description Subject Range Query Range Score Percent Strand
gudu-PA 669 CG5155-PA 1..669 1..669 3383 100 Plus