Clone BO28133 Report

Search the DGRC for BO28133

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptCG11859-RA
Protein status:BO28133.pep: Imported from assembly
Sequenced Size:1648

Clone Sequence Records

BO28133.complete Sequence

1648 bp assembled on 2011-07-18

GenBank Submission: KX796785

> BO28133.complete
GAAGTTATCAGTCGACATGGGTAAATTAAACGTGACAGTGCTGCGATATC
TCACCAAAGAGGACTTCCGCGTCCTCACCGCCATCGAGATGGGCATGAAG
AACCACGAGCTGGTCCCTGGTCCCCTGGCTGCTGCCATTGCGAATCTGAA
GTCGGGTGGAGTCCACAAGCTGCTCAAGGAGCTGTGCAAGCACAAGCTAT
TGGCCTACGAACGGGGAAAGAAATATGATGGCTACCGCTTGACAAACACG
GGCTACGACTATCTGGCTCTGAAGTCTCTCACACTGCGGGGATCGGTCAG
TTCCTTTGGCAACCAGATTGGAATTGGCAAGGAGTCCAACATCTACGTGG
TGGCTGATGAGGAGGGCACTCCAATTTGCCTCAAACTACACCGATTGGGT
CGAACTTGTTTCAGGAATGTAAAAGCCAAAAGAGACTACCACGGTCGCCG
ACACAAGGCCTCCTGGTTGTACTTATCTCGCATCTCGGCTACCCGCGAGT
TTGCCTACATGTCGGCACTCTATGATCGTGGGTTTCCAGTGCCAAAACCC
ATCGATTTCAACCGCCACTGCGTCTTAATGGACCTCGTCAAGGGCTGGCC
CATGACCCAAGTTCACGAACTTCTAGACGCTCCACAAGTTTACGATGATC
TTATGAACCTTATTGTGCGTCTGGGAAATTCTGGAGTTATTCATGGCGAT
TTTAATGAGTTTAATTTAATGGTGACAGACGCCGGCAAGCCCATACTGAT
TGATTTCCCTCAGATGATGTCCACCTCGCATGAAAATGCAGAATTTTTCT
TCGAACGCGATGTTAACTGCGTGCGTGAAATGTTCCGTCGCAAATTTGGT
TACGAAAGCGAAGACTACCCCAAGTTCAGCGACCTGGTGCGTGAGGATGA
TTTGGATGCCGAGGTACATTGCACAGGCTATGGCTTCACTAAGGAGATGG
AGCAGGATCTTCTTGAGGAGTACGGCATGGTGGATCAGGCAGATGAGGAG
GATGAGGGAGAGGATTTGGAAGAGGAGGAAGAGCCTCCCACCTTGGTTAC
CGCAGCATCTGTAGAGATTGACGAGTGCCGACGCCAGGTGGAGAACGAAG
TCATTTATAGCGAAGCCAAGCCCACTCAGAAGTCGGATGACGCAGTGCGT
CGGTACATTGAATCGTGTACGCAATATCTGGGTAATCTCAGCGTAGGTCC
AGAAGTTCCCGATCAAACAATGCCCAAAAAGTTGGACATTTCCCTGCCGG
CTGAAACTCCAGACGTTATTCCATTCGAAGCTGAAACTTCGGCAACTAAT
ACCGTTGAAGAAGACGTCAAGTCCATCAGTTCCAATGATTTAGATACGGA
TGAAGTTCCCGAGCTAGTTGGCCTGGATCCTAACTCCCGCATGTATCGTC
TCAAAATGGTCGAGCAAATGCTAAATGATGCGAGAAGTCAACGCTCCTAT
TCTACCACAACCAGCACAATAGCTCCGTCTGTGATTACCGACCGGATACG
ACGCAACATGGACATTAAGGAGAAGCGGGAGCAGCGAAAGAAGTGTGTGG
CCAAGGGAGAGGCTAGTGCTGTGCATCGTCATCGCAAGGAGAACAAGGAT
GTGGTTAAGGAGTATGCTGGCTGGGACTTCGCAAGCTTTCTAGACCAT

BO28133.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
RIOK2-RA 1617 CG11859-PA 1..1614 17..1630 8070 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
RIOK2-RA 1751 CG11859-RA 64..1677 17..1630 8070 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25266849..25267683 796..1630 4175 100 Plus
3R 32079331 3R 25266171..25266550 225..604 1900 100 Plus
3R 32079331 3R 25265907..25266114 17..224 1040 100 Plus
3R 32079331 3R 25266602..25266793 604..795 960 100 Plus
Blast to na_te.dros performed 2014-11-26 21:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 422..523 1205..1307 125 61.9 Plus
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 8939..9040 1205..1307 125 61.9 Plus

BO28133.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:43 Download gff for BO28133.complete
Subject Subject Range Query Range Percent Splice Strand
CG11859-RA 64..1677 17..1632 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:41 Download gff for BO28133.complete
Subject Subject Range Query Range Percent Splice Strand
CG11859-RA 64..1677 17..1632 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:57 Download gff for BO28133.complete
Subject Subject Range Query Range Percent Splice Strand
RIOK2-RA 64..1677 17..1632 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:57 Download gff for BO28133.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25266849..25267683 796..1632 99   Plus
3R 25266602..25266793 604..795 100 -> Plus
3R 25266171..25266549 225..603 100 -> Plus
3R 25265907..25266114 17..224 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:41 Download gff for BO28133.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21092571..21093405 796..1632 99   Plus
arm_3R 21092324..21092515 604..795 100 -> Plus
arm_3R 21091893..21092271 225..603 100 -> Plus
arm_3R 21091629..21091836 17..224 100 -> Plus

BO28133.pep Sequence

Translation from 16 to 1648

> BO28133.pep
MGKLNVTVLRYLTKEDFRVLTAIEMGMKNHELVPGPLAAAIANLKSGGVH
KLLKELCKHKLLAYERGKKYDGYRLTNTGYDYLALKSLTLRGSVSSFGNQ
IGIGKESNIYVVADEEGTPICLKLHRLGRTCFRNVKAKRDYHGRRHKASW
LYLSRISATREFAYMSALYDRGFPVPKPIDFNRHCVLMDLVKGWPMTQVH
ELLDAPQVYDDLMNLIVRLGNSGVIHGDFNEFNLMVTDAGKPILIDFPQM
MSTSHENAEFFFERDVNCVREMFRRKFGYESEDYPKFSDLVREDDLDAEV
HCTGYGFTKEMEQDLLEEYGMVDQADEEDEGEDLEEEEEPPTLVTAASVE
IDECRRQVENEVIYSEAKPTQKSDDAVRRYIESCTQYLGNLSVGPEVPDQ
TMPKKLDISLPAETPDVIPFEAETSATNTVEEDVKSISSNDLDTDEVPEL
VGLDPNSRMYRLKMVEQMLNDARSQRSYSTTTSTIAPSVITDRIRRNMDI
KEKREQRKKCVAKGEASAVHRHRKENKDVVKEYAGWDFASFLDH

BO28133.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
RIOK2-PA 538 CG11859-PA 1..538 1..538 2813 100 Plus
RIOK1-PB 585 CG11660-PB 191..395 83..276 166 24.3 Plus
RIOK1-PA 585 CG11660-PA 191..395 83..276 166 24.3 Plus