Clone BO28134 Report

Search the DGRC for BO28134

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptCG13223-RA
Protein status:BO28134.pep: Imported from assembly
Sequenced Size:1639

Clone Sequence Records

BO28134.complete Sequence

1639 bp assembled on 2011-07-18

GenBank Submission: KX795847

> BO28134.complete
GAAGTTATCAGTCGACATGCGTTCCGAAATATCTTGCTCCATGGTGCACG
ATCTGCTGGAGTCACAAAAATGCAAATTTGTGCAAACGACACCTGATTGT
CTAATCAATATGAATTTGTTCAACTACCTGGGATGGCATTATTGCAAGGT
GGATGTCCGAAATAGTTTCAATTCCTTCTGGAGTGTGTTGGGCATGTTTC
TGATTACCATTTATGTCTTCTGGATGATGCAAATAACAATAAAAAACTAC
TTCTGTCCAACTTTGATGGTAATCGCAGACTTATTGCGAATGAACGAGAG
CACGGCTGGAGTTACAGTTCTGGCCATTGCAAATGGATCACCGGATTTCT
TCACGGCGATTGCCTCGAGAGTGCAGACCTCCAAGCACTCATTCCTCTCG
TGCATGTCGCAGGCCATGTTTCTGCACATCTTTGTGGCCGGACTGGTGAT
CCTGACCAAGCCCTTCAATATGCGGGCAAACACTTACCTGAGGGATTTCG
GTTTCCTGTTCCTCAATACGGTCTACATGGATTACATCCACAAGCGACCC
AAGGGAATCAGCTGGCTAGCTGCGTTGCCCAGTGCCTTCATATTCGTTGG
CTATGTGGTGGTGGCCATCGTTGATCAGCATTTGCTGATTGCCCGCATTC
AGAAAATGGAGCAAAGACAACTGAATGTGGCTGAGGCGTTGCAGCTGGAG
GAACTGAAGCCGCAGAAGGAGATGCCACTGAAGCGGCAAGAAATCGATCG
ACCCTCCATTGGACACGGAAGTCGAAATAAGCGAATATTCCGGCAATTTT
GGAATACCGTTGCCGAATTCGACAAGGATCGATTTCATCGGGGAACCTTC
CTGGTGAAGCTGTATCTGATAGTGAAGCAACCCATCGATATGTTGTTGAG
AATACTCATTCCAAAGGTCGACATGGAGGCACCCCAGTACGGATGGTCCA
AGCTGCTCTTTAACATCCAGGTGGTTCTTGTACCCACCTACATAGCCTAC
ATAATAGTTCGAGGATATAGCATTGCGGGCTTAGCCGTCTATATGATTGC
GCTGATCCTAATGATTCCTGTGGCTACATTGATATTTTTTCTCACGCGCA
CTGACACCCCGCCCATATTTTTCAGGTTTACATCTGGCGTGGGTTTCATG
GCCGCCGTCTTCCTGATCTTCTGCTTAACCACCGAGGTGAATGCCATGTT
CTTTACGATGGCGACCATATTGCAAGTAAGCCAGGAATTCTCACTTGCCA
CGGCCATTTGCTGGGCACTAAGTAGCAACGATTTGGTGGCCAATCTGTCA
CTGGCCCATCAGGGATGGCCTCGCATGGCAATGACGGCCACATTCTCAGC
ACCAGTATTTGCATCCTTTGTTTTCTTGGCCCTGCCATTGGTGGTGAACT
CGTTTGTAAACGCGCCCGGTAACATATTCCCAACGGAAGGTGGATTTGGG
GAGACGGTTTGCATCTTCTTGGAGGTTGGAATGGGCTTCTCCATGCTTTC
CGTACTAACCACAAACTTTAAGCTGCGACGAGCTTGTGGCTTTCTACTCG
TTTCCTACTACATTTTCTTCGTGGGAGTTCTAATTCTGCTGGAGAAGGGC
GTAATCCATGCATACGGCGTGGCAAGCTTTCTAGACCAT

BO28134.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13223-RA 1584 CG13223-PA 1..1581 41..1621 7905 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:36:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG13223-RA 1769 CG13223-RA 71..1675 17..1621 8025 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11256871..11257274 250..653 2020 100 Plus
2R 25286936 2R 11257325..11257678 654..1007 1770 100 Plus
2R 25286936 2R 11258062..11258297 1126..1361 1180 100 Plus
2R 25286936 2R 11256577..11256809 17..249 1165 100 Plus
2R 25286936 2R 11258482..11258673 1430..1621 960 100 Plus
2R 25286936 2R 11257732..11257852 1006..1126 605 100 Plus
2R 25286936 2R 11258354..11258422 1361..1429 345 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:36:14 has no hits.

BO28134.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:40 Download gff for BO28134.complete
Subject Subject Range Query Range Percent Splice Strand
CG13223-RA 71..1675 17..1623 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:21 Download gff for BO28134.complete
Subject Subject Range Query Range Percent Splice Strand
CG13223-RA 71..1675 17..1623 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:37:38 Download gff for BO28134.complete
Subject Subject Range Query Range Percent Splice Strand
CG13223-RA 71..1675 17..1623 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:37:38 Download gff for BO28134.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11258482..11258673 1430..1623 98   Plus
2R 11258355..11258422 1362..1429 100 -> Plus
2R 11258063..11258297 1127..1361 100 -> Plus
2R 11257734..11257852 1008..1126 100 -> Plus
2R 11257325..11257678 654..1007 100 -> Plus
2R 11256871..11257274 250..653 100 -> Plus
2R 11256577..11256809 17..249 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:21 Download gff for BO28134.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7145987..7146178 1430..1623 98   Plus
arm_2R 7145860..7145927 1362..1429 100 -> Plus
arm_2R 7145568..7145802 1127..1361 100 -> Plus
arm_2R 7145239..7145357 1008..1126 100 -> Plus
arm_2R 7144830..7145183 654..1007 100 -> Plus
arm_2R 7144376..7144779 250..653 100 -> Plus
arm_2R 7144082..7144314 17..249 100 -> Plus

BO28134.pep Sequence

Translation from 16 to 1639

> BO28134.pep
MRSEISCSMVHDLLESQKCKFVQTTPDCLINMNLFNYLGWHYCKVDVRNS
FNSFWSVLGMFLITIYVFWMMQITIKNYFCPTLMVIADLLRMNESTAGVT
VLAIANGSPDFFTAIASRVQTSKHSFLSCMSQAMFLHIFVAGLVILTKPF
NMRANTYLRDFGFLFLNTVYMDYIHKRPKGISWLAALPSAFIFVGYVVVA
IVDQHLLIARIQKMEQRQLNVAEALQLEELKPQKEMPLKRQEIDRPSIGH
GSRNKRIFRQFWNTVAEFDKDRFHRGTFLVKLYLIVKQPIDMLLRILIPK
VDMEAPQYGWSKLLFNIQVVLVPTYIAYIIVRGYSIAGLAVYMIALILMI
PVATLIFFLTRTDTPPIFFRFTSGVGFMAAVFLIFCLTTEVNAMFFTMAT
ILQVSQEFSLATAICWALSSNDLVANLSLAHQGWPRMAMTATFSAPVFAS
FVFLALPLVVNSFVNAPGNIFPTEGGFGETVCIFLEVGMGFSMLSVLTTN
FKLRRACGFLLVSYYIFFVGVLILLEKGVIHAYGVASFLDH

BO28134.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG13223-PA 527 CG13223-PA 1..527 9..535 2719 100 Plus
CG12376-PA 617 CG12376-PA 23..606 5..535 525 25.8 Plus
CG14744-PC 620 CG14744-PC 26..611 5..533 514 25.2 Plus
CG5348-PB 625 CG5348-PB 31..612 5..533 475 25 Plus
CG14743-PB 611 CG14743-PB 24..601 5..533 457 22.6 Plus