Clone BO28137 Report

Search the DGRC for BO28137

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG10029-RA
Protein status:BO28137.pep: Imported from assembly
Sequenced Size:1264

Clone Sequence Records

BO28137.complete Sequence

1264 bp assembled on 2011-07-18

GenBank Submission: KX799145

> BO28137.complete
GAAGTTATCAGTCGACATGAAAGTGGTCGGCAGTTTGCATATCCTCTATT
CGCTGGCGATCTTAGTATCCCTACATTCTCTCGTCGCGGGAAACTCTTCG
GTGGTGGCGGTGACCCACGAAAACTTGCAAGGAATAATCGATTCTAATGA
GTTGGTTCTGCTTAGTTTTTACACGGATTGGTGCCGTTTTAGCCAGATTT
TGCAGCCCATTTTTGAGGAGGCGGCGGCGAAGGTTATACAGAAATTCCCT
GAAAACGGCCGTGTGATCCTGGGAAAAGTAAACTGCGACACTGAAGATAT
ATTGGCCGATCAGTTTGACATACTTAAGTACCCAACGATAAAGATCGTCA
GGAATGGATTGATTGGCAATCAGGAATACCGTGGCCAGAGATCGGTGGAG
GCCCTTTTCCAGTTCGTGGAAAAGGAGCTATCAGATCCAATCAAAGAGTT
CCATAACATTGATGACCTTAAAAACGTGGATGTTGGGTATGGAATAGTCA
TTGGTTATTTCATTTCCAAGGATCATGCTGAGTATGATAACTATCGCAGG
GTAGCGAGCCTTTTGCGCAACGATTGTAGGTTCCTTGTGGGCTTTGGTGA
CTTGACTAAGGACCTCCGACCGCCAGGAAAGAACGCGTTGATCTTCCGAG
GCGATCCATCGATTCCGAATCACAAAAACCAGTACAGTGAGTACTTGGGC
AACATGACCAGCTTTAAAGAACTAACCTTTTGGATCGATAAGACGTGTGT
GCCCCTGGTGCGAGAGGTCACCTTCGATAATGCAGAGGAACTATCGGAGG
AAGGATTACCATTTGTATTGCTATTTTACAACAAGGACGATCTAAGTCCC
ATCCAGGAGTTCAAGAACGCAATTCAAAGCCAGATGGAAAATGAGACGAG
GGTTATTTTCCTGACTGCCGAAGGAGAAGTCTTTAAGCACCCACTTTTCC
ATTTGGGAAAGTCCCCGAGTGATTTGCCAGTGATCGCAATCGATTCCTTC
ATGCACATGTACCTATTTCCACGCTTCCAGGACATTTACGATCCAGGTGC
CCTCAAAAAGTTCATTGATGACCTGTTCAGCGGTGCACTGCATTATAATT
ACCATGTGGCCCAGCAGGCTAAGGAAGATTTGGAGTCCATTATCGATCCA
ACTGAAGACCTGCCAGTCGTTCACGAGTCCAAGTTTAAGGACCTCAAGCC
ATCCAAGCACCGTTACACGTTGGTCAACCGCACAAGGGACGAGCTAGCAA
GCTTTCTAGACCAT

BO28137.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG10029-RB 1233 CG10029-PB 1..1230 17..1246 6135 99.9 Plus
CG10029-RA 1233 CG10029-PA 1..1230 17..1246 6135 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG10029-RB 1665 CG10029-RB 39..1268 17..1246 6135 99.9 Plus
CG10029-RA 1380 CG10029-RA 39..1268 17..1246 6135 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7315836..7316504 1246..578 3345 100 Minus
3R 32079331 3R 7316605..7317169 581..17 2810 99.8 Minus
Blast to na_te.dros performed on 2014-11-26 21:37:40 has no hits.

BO28137.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:43 Download gff for BO28137.complete
Subject Subject Range Query Range Percent Splice Strand
CG10029-RA 39..1268 17..1248 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:54 Download gff for BO28137.complete
Subject Subject Range Query Range Percent Splice Strand
CG10029-RA 39..1268 17..1248 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:11 Download gff for BO28137.complete
Subject Subject Range Query Range Percent Splice Strand
CG10029-RA 39..1268 17..1248 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:11 Download gff for BO28137.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7316607..7317169 17..579 99   Minus
3R 7315834..7316502 580..1248 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:54 Download gff for BO28137.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3142329..3142891 17..579 99   Minus
arm_3R 3141556..3142224 580..1248 99 <- Minus

BO28137.pep Sequence

Translation from 16 to 1264

> BO28137.pep
MKVVGSLHILYSLAILVSLHSLVAGNSSVVAVTHENLQGIIDSNELVLLS
FYTDWCRFSQILQPIFEEAAAKVIQKFPENGRVILGKVNCDTEDILADQF
DILKYPTIKIVRNGLIGNQEYRGQRSVEALFQFVEKELSDPIKEFHNIDD
LKNVDVGYGIVIGYFISKDHAEYDNYRRVASLLRNDCRFLVGFGDLTKDL
RPPGKNALIFRGDPSIPNHKNQYSEYLGNMTSFKELTFWIDKTCVPLVRE
VTFDNAEELSEEGLPFVLLFYNKDDLSPIQEFKNAIQSQMENETRVIFLT
AEGEVFKHPLFHLGKSPSDLPVIAIDSFMHMYLFPRFQDIYDPGALKKFI
DDLFSGALHYNYHVAQQAKEDLESIIDPTEDLPVVHESKFKDLKPSKHRY
TLVNRTRDELASFLDH

BO28137.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG10029-PB 410 CG10029-PB 1..410 1..410 2137 100 Plus
CG10029-PA 410 CG10029-PA 1..410 1..410 2137 100 Plus
CG9911-PA 412 CG9911-PA 8..412 4..410 1040 49.9 Plus
CG9911-PB 412 CG9911-PB 8..412 4..410 1040 49.9 Plus
CG9911-PD 412 CG9911-PD 8..412 4..410 1040 49.9 Plus