Clone BO28154 Report

Search the DGRC for BO28154

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptCG1077-RA
Protein status:BO28154.pep: Imported from assembly
Sequenced Size:2224

Clone Sequence Records

BO28154.complete Sequence

2224 bp assembled on 2011-07-18

GenBank Submission: KX799051

> BO28154.complete
GAAGTTATCAGTCGACATGGCCGGGAGAAGGGTGATTGGTCTCTGTTTTG
GAATATTCTTACAAGTGCTGCTAGCGACTGCTGGACAGGATCGGATGAGC
ATGCTCTGTTCCGACGACGACACACCAGCCTGTGCCCAGAGCCGCGAAAA
TGGAATGTACTTTTTGTTCGCCAACGAGTGTGACCTTCGGAAGGCCCAGC
GTGGCAACCTCATGAATGGCCCTCTATATGACGTTACGCTTCGATTCTGC
TTTCCCAGCTGCGAATTCGAGTGCAGCTCAAGATATCAGCCAGTTTGTGG
CATCAGCTCGAAGTCGGGGGAACGAAAGACCTTCAGGAGTCGCTGCGAAA
TGCTGCGAACCGCTTGCATCTCAAGGTCGGAGTGGATGGTCCATCGATGG
GGAGTGTGTCCAAAAGCCAACGCGGTGCCACAGATCAGTGAAAAGCCGCC
TGTGCCCGTGCCCTGCACCAGGATCTATCGACCTGTTTGCGCCATGTACG
CTGGTGTCAAGTCAACCTTCTCCAACGAGTGTTTGGTGAACGCGGAAAAC
ATCAAGTCCCAGAGAAACTGGCGCATCGTTTCCGAGGGCCTTTGTGGCGA
GGACAGCACCAAGATGAAGCATAGTCGCAAGCAGAAGCCGAAGGCCAAGC
CCAAGTCGGATGCGGAGCGCACCAAGCGGAGCCACAGAGGCAAGAGGCTG
TCCACTCAGGCGGAAGACTTCCAGATACCGGAGGACGCCGTGGAGATTTA
CGCTCCCTCGACCTTTCACACGCAGTTCATCAGCCAATCGGGCGCCATGG
AGAAGAGCTACTCTCTGCCCGCCAGGAAGCCCTATGTGGTGGTCCCGCCT
AAATCGAAGCGGCGAATCCCCACAAAGTCTTGTGTTTTCGGCAATGAGCC
TGTTTGCGGGAACTTAAGAGGGCAGAGTCGCACCTTTTCCAACGTTTGTG
AACTCATGGAGTTTAGCCAAAAAGTCGGAAATGCATGGACCATTGCTCAC
AATGGAGCCTGTCGCCGCTGCGATAAGACTTGTCCTACGGTTTATCAACC
TATTTGTGCCACCAGAAACGGCATCAATCACACAATCGTCAACGAGTGCT
ATTTGGAGCGAGTGCGCTGCAAGGATCCAAAAAGCATATGGAAGCTATCC
CACAAAGGTGAGTGCGCCAAGTCAGTGAGCAACCCACGGCACATTTACTC
CACTGGTAAAAGTCGCCCAACGTCTTTGGTGCCAAGTGTTTTATACGGAA
AGAGCACCACCACACCACGAAGTCGCTTCAGGAAACCAGTACGTAGGTTC
ACAACCACAAGGACTCCAACCACACCATACAAGCCACGTCAGCTGGCGAT
GACAAATTTCTCGGCCACTTCGCCTTCCCTGGAAACCAATAATCGCAAAA
TACGCAAAATTGAGCTCGCTGCTGCGGGATTTTCGGGCTTGGGTGCGTCA
AGCGGGTCAAATTTTCTGAGCTCTGAGGAAGATGCTTTCTGGTCCTCTGA
TGACAGTTGGCTGGTGCAGAAAACTCTCGATAATGTCAAGGGCTTGCTTG
GCAATAAGCCTACTTCCTTGAAGAAGGAGCACGGTGAGAAGTACCCACTG
TCCTATTGGATTGTCCCACCAAGGCAAACAAGTACTATCAGCACCACCAC
AGCTGCACCACCAGCTAAACTACCAGCTATTCTCAGCATGGCATCCACGG
AGCTATTAAATTTGGATTTTGGAAACCCTTCCAGCGCTTACGAAGAAGCT
GATCACGAAGCGATGCTCATGCTGACCACTAAAGAGGGCACCACCTCAAC
CACACCTGTGCCCAGCACCACTACACCGCCCAACATCACCGAACCTTCTA
CTACTGAATTGCCCACCAGTGTTGACGTTGCCTCTGACTCGGCGGAAACG
GTCAGTGAAGACTCCACGACGGATTTCGGAGAAACGACTGATCCAACGAC
CAGCAACGATTCCAGCACCTCAGATGCACCACAATCTTCGACCACAGAGG
CCGAGGAGTTGAACAGCCAAACCACCGGGAGCGAGTCCACCACCACCGTG
GCCTCCGACAAGCTGTCTACGACCACTTTAAATGCCGACTACGCGGTGGA
TGAGTCATTTTCCGAGTCCAGTGGTCAGACCTCCATCTATGGGCTCGACA
AGAACTCCTTGATCATGAGGTTGCTACGTGCCAGAAGTAACCAAAACGTG
CTCATCGCAAGCTTTCTAGACCAT

BO28154.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG1077-RA 2193 CG1077-PA 1..2190 17..2206 10950 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG1077-RA 2302 CG1077-RA 34..2225 15..2206 10960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6169163..6170232 1137..2206 5350 100 Plus
3R 32079331 3R 6168368..6168784 567..983 2085 100 Plus
3R 32079331 3R 6167884..6168222 228..566 1695 100 Plus
3R 32079331 3R 6167516..6167732 15..231 1070 99.5 Plus
3R 32079331 3R 6168955..6169108 983..1136 770 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:38:30 has no hits.

BO28154.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:45 Download gff for BO28154.complete
Subject Subject Range Query Range Percent Splice Strand
CG1077-RA 1..2190 17..2208 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:32:17 Download gff for BO28154.complete
Subject Subject Range Query Range Percent Splice Strand
CG1077-RA 36..2225 17..2208 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:29 Download gff for BO28154.complete
Subject Subject Range Query Range Percent Splice Strand
CG1077-RA 36..2225 17..2208 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:29 Download gff for BO28154.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6169163..6170232 1137..2208 99   Plus
3R 6168956..6169108 984..1136 100 -> Plus
3R 6168368..6168784 567..983 100 -> Plus
3R 6167884..6168222 228..566 100 -> Plus
3R 6167518..6167728 17..227 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:32:17 Download gff for BO28154.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1994885..1995954 1137..2208 99   Plus
arm_3R 1994678..1994830 984..1136 100 -> Plus
arm_3R 1994090..1994506 567..983 100 -> Plus
arm_3R 1993606..1993944 228..566 100 -> Plus
arm_3R 1993240..1993450 17..227 100 -> Plus

BO28154.pep Sequence

Translation from 16 to 2224

> BO28154.pep
MAGRRVIGLCFGIFLQVLLATAGQDRMSMLCSDDDTPACAQSRENGMYFL
FANECDLRKAQRGNLMNGPLYDVTLRFCFPSCEFECSSRYQPVCGISSKS
GERKTFRSRCEMLRTACISRSEWMVHRWGVCPKANAVPQISEKPPVPVPC
TRIYRPVCAMYAGVKSTFSNECLVNAENIKSQRNWRIVSEGLCGEDSTKM
KHSRKQKPKAKPKSDAERTKRSHRGKRLSTQAEDFQIPEDAVEIYAPSTF
HTQFISQSGAMEKSYSLPARKPYVVVPPKSKRRIPTKSCVFGNEPVCGNL
RGQSRTFSNVCELMEFSQKVGNAWTIAHNGACRRCDKTCPTVYQPICATR
NGINHTIVNECYLERVRCKDPKSIWKLSHKGECAKSVSNPRHIYSTGKSR
PTSLVPSVLYGKSTTTPRSRFRKPVRRFTTTRTPTTPYKPRQLAMTNFSA
TSPSLETNNRKIRKIELAAAGFSGLGASSGSNFLSSEEDAFWSSDDSWLV
QKTLDNVKGLLGNKPTSLKKEHGEKYPLSYWIVPPRQTSTISTTTAAPPA
KLPAILSMASTELLNLDFGNPSSAYEEADHEAMLMLTTKEGTTSTTPVPS
TTTPPNITEPSTTELPTSVDVASDSAETVSEDSTTDFGETTDPTTSNDSS
TSDAPQSSTTEAEELNSQTTGSESTTTVASDKLSTTTLNADYAVDESFSE
SSGQTSIYGLDKNSLIMRLLRARSNQNVLIASFLDH

BO28154.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG1077-PA 730 CG1077-PA 1..730 1..730 3836 100 Plus
Mur11Da-PD 626 CG32644-PD 192..462 410..706 179 25.5 Plus
CG46026-PA 666 CG46026-PA 349..650 386..707 162 24.8 Plus
Muc68D-PB 1514 CG6004-PB 545..847 395..705 160 23.7 Plus