Clone BO28158 Report

Search the DGRC for BO28158

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG15170-RA
Protein status:BO28158.pep: Imported from assembly
Sequenced Size:1717

Clone Sequence Records

BO28158.complete Sequence

1717 bp assembled on 2011-07-18

GenBank Submission: KX799085

> BO28158.complete
GAAGTTATCAGTCGACATGCGTGGACTGCAGACAAATCGCCACTCAAGCT
TCCACCACCTGCTCCTCCTTTTCCTGGTCCTCCTGAGATCAGACCGTTGT
TTTGGCATTGTTTGCTACCACTGCGATTCCATTGCCCTGCCGGAATGTTC
CCAGACCCTCGGAGAAGTGGGAGTTCTTCCCTACAAGGAGTGCGCTACCG
AGCTGACGTGTGCCATGTCCATTGTGGACTCCATTACATACCGCGGCTGC
GGAGCAGAAACCCCCATCATCGGAGCGACTTACTCAAAGACTTGCTCAAC
GAACCTGTGCAATGCGGGTGTCTATCCGCCGGGACGACTTAAGTGCCATC
ATTGCGCTGGACAGGAATGCGTGGCAGCTCCAGCATCCAAACCAAAACCC
TGTCGCTATCATTTGGAAGAGGATCAGTGCTACACGGATGTCATAAGTTC
TTCAGATGCCTACAGAGGTTGTACCTCCGAGCAGAATCACACGCTGTCCA
CTTCCGCCCAACTGTGTGAGATCAATGGCTGCAATGAGGAGCAAGGAGCT
TGGACCCAAGTCTGCGCCACCTGCGATTCAGCAATCGGCCGGGGTTGCAA
GATAGATCTCTTTCAGGTCAACACCGGCAGGTGCAATGTTAGCTTATACG
AGGAATGCCAGCAGGATGTTCTGTTGGGTGAGCAAGAGGATAAGTACTGC
TTCAGCTTTCGCAGACTAAGCCGCGTTGTCAGAGGATGTTCTACTAAAAT
TCCAACAGATTTGGAGCCGTATGTAGAGCAATTAGAAAAGTGTAATACCA
GTGACCACTGCAACGCAGGATGCATTACGCAGCAGAAGTGTTTTACATGC
AACTCCGTGGATCAGGAACTTTGCCGGACAAATATTACGGCTATAGCTAA
TAGCACTTGTAGCTCCGCTGAGGCCTCTTCCTGTTTCTCCTGTGAGTACT
CCAACTGGAGTATTCAGCGAGGCTGTGGAGCACCGCCGGAAAATCCTCAA
ATCACCAAGTGCTATGAATGCGATGAAGGCGCTGGGTGTAATAGTAAGGA
TTTCACCCGGTGCTACCAATGCAGCACGGATCAAGCGGGAGCAGGCTGTG
CAAATTGGGAAAGTCCTGGCGAAATCTACATTGAAGAATGCGATGAACCG
GCTGCACCATGTGTGGTTGTTTCCTTTAACAACGCCACCACTGCGAGAGG
TTGCCAAAAATCGGACTTCAGCTGTGCTTCCGCAAATGTGGCCAGTTGTC
GACTATGCGAAGGAAGTTTCTGCAACAAAGGATCATTTCCGGAGGAGCGC
CTCTGGTGTCATCAGTGTAGGGGAGTGCAGGACTGCGAGGAGATCTCCAG
GGGACAAACGGCTATGCCTTGTCCGGCTCGAGCAAATGAGCCGGAGGATC
AAGAATTGGCCTGCTTGGAGTACTTTGACATCAACAGTAAAGAAATTGTA
AGAGGATGTCGTTCCAATCCCGAGCTATACTACGAATGTCTCTTAAGGAG
TAACCACTTCGACAGTTGTCGCACTTGTCACAGTCAGGCATGCAATAATA
GTCCTGGCCGGGAATTAAGAGCCAGCTATGAGCTGGAGGCCAAGGCATTG
TCCTTGTTGCAAGGCAAGAGTTCCGCAATATCCATCAAATTTTCGAATGC
AGGTTACGGAGTTTGGTTGATCTTTAGCGTTATCTATATTGTAACTTGCG
CAAGCTTTCTAGACCAT

BO28158.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG15170-RA 1686 CG15170-PA 1..1683 17..1699 8415 100 Plus
CG15170-RB 1683 CG15170-PB 1..1680 17..1699 8335 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG15170-RA 1718 CG15170-RA 7..1689 17..1699 8415 100 Plus
CG15170-RB 1715 CG15170-RB 7..1686 17..1699 8335 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18988297..18989772 1699..224 7380 100 Minus
2L 23513712 2L 18989953..18990087 224..90 675 100 Minus
2L 23513712 2L 18990155..18990227 89..17 365 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:38:02 has no hits.

BO28158.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:44 Download gff for BO28158.complete
Subject Subject Range Query Range Percent Splice Strand
CG15170-RA 7..1689 17..1701 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:32:04 Download gff for BO28158.complete
Subject Subject Range Query Range Percent Splice Strand
CG15170-RA 7..1689 17..1701 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:20 Download gff for BO28158.complete
Subject Subject Range Query Range Percent Splice Strand
CG15170-RA 7..1689 17..1701 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:20 Download gff for BO28158.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18990155..18990227 17..89 100   Minus
2L 18989953..18990087 90..224 100 <- Minus
2L 18988294..18989771 225..1701 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:32:04 Download gff for BO28158.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18990155..18990227 17..89 100   Minus
arm_2L 18989953..18990087 90..224 100 <- Minus
arm_2L 18988294..18989771 225..1701 99 <- Minus

BO28158.pep Sequence

Translation from 16 to 1717

> BO28158.pep
MRGLQTNRHSSFHHLLLLFLVLLRSDRCFGIVCYHCDSIALPECSQTLGE
VGVLPYKECATELTCAMSIVDSITYRGCGAETPIIGATYSKTCSTNLCNA
GVYPPGRLKCHHCAGQECVAAPASKPKPCRYHLEEDQCYTDVISSSDAYR
GCTSEQNHTLSTSAQLCEINGCNEEQGAWTQVCATCDSAIGRGCKIDLFQ
VNTGRCNVSLYEECQQDVLLGEQEDKYCFSFRRLSRVVRGCSTKIPTDLE
PYVEQLEKCNTSDHCNAGCITQQKCFTCNSVDQELCRTNITAIANSTCSS
AEASSCFSCEYSNWSIQRGCGAPPENPQITKCYECDEGAGCNSKDFTRCY
QCSTDQAGAGCANWESPGEIYIEECDEPAAPCVVVSFNNATTARGCQKSD
FSCASANVASCRLCEGSFCNKGSFPEERLWCHQCRGVQDCEEISRGQTAM
PCPARANEPEDQELACLEYFDINSKEIVRGCRSNPELYYECLLRSNHFDS
CRTCHSQACNNSPGRELRASYELEAKALSLLQGKSSAISIKFSNAGYGVW
LIFSVIYIVTCASFLDH

BO28158.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG15170-PA 561 CG15170-PA 1..561 1..561 3106 100 Plus
CG15170-PB 560 CG15170-PB 1..560 1..561 3082 99.6 Plus
CG15773-PA 478 CG15773-PA 33..442 33..420 431 31.7 Plus
CG15773-PB 319 CG15773-PB 33..317 33..310 312 33.3 Plus
CG13492-PD 2979 CG13492-PD 763..1365 21..512 263 22 Plus