Clone BO28166 Report

Search the DGRC for BO28166

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG3270-RA
Protein status:BO28166.pep: Imported from assembly
Sequenced Size:1354

Clone Sequence Records

BO28166.complete Sequence

1354 bp assembled on 2011-07-18

GenBank Submission: KX794068

> BO28166.complete
GAAGTTATCAGTCGACATGCTGGGCCTGCGACGAGTTCTGCGATTGGGTG
CACTGCGTCAGCTTCGCTCGTTAAGTGGCAAGCCGCAAGGCGATGTCCTT
CCCGGGAGCTGCGGAGTCCTGATAATAGGTGGCGGTGGCATGGGCGCCTC
CTCCGCTTTCTGGCTGAAGTCCCGGGCCCTGCAGCTGGGCCGCAAGCTCA
ATGTGCTGGTGGTGGAGCGCGATGCTGGTTACACCAGCGCATCTACAGTG
CTTTCTGTAGGCGGAGTGCGGCAGCAGTTCTCTTTGGCCGAGAACATAGA
GATGTCGCTCTTCGGATACAACTTCGTGGTTAACGGCAGGGAGCATCTGG
GCGACGTGGATCTGTGCTACCAGCCGAACGGCTACCTGATCCTTGCCTCC
GAGAAGGGAGCCCACATCCTAGCAAAGAACTCAAAGCTACAGAACGAGCT
GGGGGCCCGAAATGAGCTGCTAGGCCCGGAGGCACTGCGTCAGCGGTTTC
CGTGGTTGTCCACAGAGGGCGTGGAGCTGGGATGCCACGGGATTGACAAG
GAGGGATGGTTTGATCCGTGGGCCCTGCTCATGGGCTACAAGAAGAAGGC
CCGTGCATTGGGGGCGAATTTCGCGAACGGTTCGGTAGTGGGTTTTGAGT
GGAACGATTCGGGCGGCCTTTCTGGAGCTGTGGTCGACGCCGGAGATGTG
TTGCAGCGCACGGTGAAGTTTGACACGTGCGTTCTGGCAGCGGGAGCGTA
CTCGGGTCAGGTGGCGCGTCTGGCAGGGATTGGTGATAAGGAAGCAAAGG
AGGCTTCCCTGAGTGTAGCCCTGCCGGTGGAGCCTCGCAAGCGATACGTC
TATGTGGTTAGCACTCAGGGTAAGAATTGTCCTGGGCTAGCCACACCTCT
GACCGTTGATCCCGATGGCACCTACTTCAGGCGGGACGGTCTTTGCGGCA
ACTTCCTGTGCGGCCGCAGTCCAAACGAAGACGAGGAGCCGGAGTGCGAA
ACGCTGGACGTGGACCACGGGTACTTTGAAACGGATGTCTGGCCCACACT
GGCGAACCGAGTTCCTGCTTTTGAGTCTGTGAAGATACAGAGCAGCTGGG
CGGGCTTCTATGACCACAACACATTTGACGCAAACGGCGTCATCGGCAGG
CATCCTCACTACAGCAATCTCTTCATTGCCGCAGGCTTCAGTGGGCACGG
CATTCAGCAGACTCCCGCCGTGGGTCGAGCCATTTCCGAACTAATCTTGG
ACGGCAAGTTTACCACACTGGATCTGTCGCGCCTCGGCTTCGAACGCCTT
GTAAACCAACAGCCTATGCACGAAGTGAATATCGTTGCAAGCTTTCTAGA
CCAT

BO28166.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG3270-RA 1323 CG3270-PA 1..1320 17..1336 6600 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG3270-RA 1449 CG3270-RA 11..1330 17..1336 6600 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6693962..6695068 230..1336 5535 100 Plus
2R 25286936 2R 6693440..6693652 17..229 1065 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:38:42 has no hits.

BO28166.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:45 Download gff for BO28166.complete
Subject Subject Range Query Range Percent Splice Strand
CG3270-RA 1..1320 17..1338 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:32:24 Download gff for BO28166.complete
Subject Subject Range Query Range Percent Splice Strand
CG3270-RA 11..1330 17..1338 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:33 Download gff for BO28166.complete
Subject Subject Range Query Range Percent Splice Strand
CG3270-RA 11..1330 17..1338 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:33 Download gff for BO28166.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6693962..6695068 230..1338 99   Plus
2R 6693440..6693652 17..229 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:32:24 Download gff for BO28166.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2581467..2582573 230..1338 99   Plus
arm_2R 2580945..2581157 17..229 100 -> Plus

BO28166.pep Sequence

Translation from 16 to 1354

> BO28166.pep
MLGLRRVLRLGALRQLRSLSGKPQGDVLPGSCGVLIIGGGGMGASSAFWL
KSRALQLGRKLNVLVVERDAGYTSASTVLSVGGVRQQFSLAENIEMSLFG
YNFVVNGREHLGDVDLCYQPNGYLILASEKGAHILAKNSKLQNELGARNE
LLGPEALRQRFPWLSTEGVELGCHGIDKEGWFDPWALLMGYKKKARALGA
NFANGSVVGFEWNDSGGLSGAVVDAGDVLQRTVKFDTCVLAAGAYSGQVA
RLAGIGDKEAKEASLSVALPVEPRKRYVYVVSTQGKNCPGLATPLTVDPD
GTYFRRDGLCGNFLCGRSPNEDEEPECETLDVDHGYFETDVWPTLANRVP
AFESVKIQSSWAGFYDHNTFDANGVIGRHPHYSNLFIAAGFSGHGIQQTP
AVGRAISELILDGKFTTLDLSRLGFERLVNQQPMHEVNIVASFLDH

BO28166.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG3270-PA 440 CG3270-PA 1..440 1..440 2310 100 Plus
l(2)37Bb-PA 515 CG10655-PA 98..515 32..442 1050 49.5 Plus