Clone BO28179 Report

Search the DGRC for BO28179

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptCG4009-RB
Protein status:BO28179.pep: Imported from assembly
Sequenced Size:1981

Clone Sequence Records

BO28179.complete Sequence

1981 bp assembled on 2011-07-18

GenBank Submission: KX793922

> BO28179.complete
GAAGTTATCAGTCGACATGAGAGTGTTTTTGGTGGTGTTGAGTGTGCTGT
CTGTGGCGGTGGCCACCAAGTGTCCGTATTCGGCAATGGAACCCTCCTTG
TCCAGGTCCAAACGGAGTTCTTTTGATATTCGCCCAGGAGTTAGTGACGG
AAGTTTGGATGCCTTGATTAAAGAATTTATGCCCAAGTACAATGGCAACA
ATGTTCACAATAGTTGGGCCGAGCCTTCTGCCTCCCAACAACCTTTAAGA
TGTGGAGTTCCGCCTCGCAACTGCTTGAATGATACTCGAAATCTGCACTA
CCGAACCTTGGATGGATCATGCAACAATCTGTTGTATCCGGAGTTTGGAA
TTGCCGTTTCGCGCTATCGTAGGCTTTTGCCTCCTCGCCAAGTGGAACAG
GCTCCGAATGCCCGTTTGATCTCCTTGTCGCTGTACGGCGAGCAGACGAG
GAACGATAGGTTCCGCACCATGGCGGCCATGCAATGGGGCCAGTTTGTTG
CCCACGATATCAGCCAATTGAGCACACAGGGCGCTCCTCAAGATTGCTGT
GCCGAGCCGCGTCATCCTCGCTGTCTGCCAATCAACCTGCCCCGTGGTGG
TCCCATCGCATACCATACGGGCAAGACCTGTCTGCACTTTGCACGCAGTG
TGTCGGATGCGGATGCCATATGCCCAAAGGTTGAGGAACCCCAACCGGAA
AAGCTAACGGTGGCAACTGCTTACCTGGATCTCTCCTCCATCTACGGCAA
CAATCCCTCGCAAAACAGAAAGGTCCGCTTGTTCAAGGGCGGACTTCTGA
AGACCAGCTACACGAACGGACAACACTGGCTACCGGTGAGCCAAAATGAG
AATGGCGAGTGCGGTGCCAAGAGTGAGTGCTACATCGTACCGGACATTCG
GAATCGTTTCTCGCCCACCATCGCCCTATTGCAGACTCTGTTGGTCCGAG
AGCACAATCGTCTGGCCGAAAATCTAGCGCTGATTAATCCCGATCATAGT
GACGAGCGCATCTTCCAGGAGGCACGCAAGATTAACATTGCGCAGTTCCA
GAAGATCACATACTATGACTGGCTTCCACTGTTCGTTGGTCGCACCTATA
CCTACTTGAACGGACTGATTTATCCAGTGGAGCCCACCGAGTATGTCAAC
GACTACGACGAGACGGTTAATCCTGCTGCCTATGCGGAGTTTTCTGCTGC
CGCCTTTAGATACGCCCACACCCAAATCCCCGGATGGTTTTCATTGGTTG
CCCCCAATCGGAGATCTAATAGAACCATGCGCCTGAGCGACTTCCTCGAC
CGTACAGAGACTATTCGTTTACTGGACACATCCGACAACTTCGATGCCCT
GTTGAGAGGCTTGGCTACCCAGTTGCACAAGCGATCGGATGGGAACATTG
ATCGGGAGATCAAGCACTACTTCAACCGCAAGGAGTTCGAGGAATACGGT
TCGGATCTGAAGTCTATAGATATTCAGAGGGCACGAGACTTCGGATTGGC
TTCCTACAACGATGTGCGAGAGTTTTGTGGTCTGCGACGAGCTGTCGATT
GGGCGGATTTCGCTCACGAAATTCCCGGAGAGAAAATATCGCTGTTGCGC
CGACTGTACGCCACTCCGGATGACGTGGAACTTGGTGTTGGCGGTACCTT
GGAGTACCATGTCCCAGATGCTCTATTCGGACCAACTTTGTTGTGTGTGA
TTGGAAAACAGTTCCTTAACACGCGACGTGGCGATAGATTCTTCTTTGAG
CGGGAGAACGAAGGAGGTTTTTCGCGCGCTCAATTGGCCGAGATCCGGAA
AGTGAGCCTGTCCAGCTTGTTCTGCAGCAATGCCAACTATCTGCATTTAA
TCCAGCCAAACGTATTTGTCTTCCCGAATTCACATAATCTACTACTGAAC
TGCAATTTTATTCCTCAAATCGATCTAAGCAAATGGCAGGATCTCAGGCC
TCAGCTTGTTCACGCAAGCTTTCTAGACCAT

BO28179.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG4009-RC 1950 CG4009-PC 1..1947 17..1963 9705 99.9 Plus
CG4009-RB 1950 CG4009-PB 1..1947 17..1963 9705 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG4009-RC 2214 CG4009-RC 28..1974 17..1963 9705 99.9 Plus
CG4009-RB 2086 CG4009-RB 28..1974 17..1963 9705 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17034793..17036018 1242..17 6100 99.8 Minus
3R 32079331 3R 17034388..17034727 1582..1243 1700 100 Minus
3R 32079331 3R 17034134..17034331 1778..1581 990 100 Minus
3R 32079331 3R 17033965..17034071 1884..1778 535 100 Minus
3R 32079331 3R 17033828..17033906 1963..1885 395 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:39:06 has no hits.

BO28179.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:46 Download gff for BO28179.complete
Subject Subject Range Query Range Percent Splice Strand
CG4009-RB 28..1974 17..1965 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:32:35 Download gff for BO28179.complete
Subject Subject Range Query Range Percent Splice Strand
CG4009-RB 28..1974 17..1965 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:42 Download gff for BO28179.complete
Subject Subject Range Query Range Percent Splice Strand
CG4009-RB 28..1974 17..1965 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:42 Download gff for BO28179.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17034793..17036018 17..1242 99   Minus
3R 17034388..17034727 1243..1582 100 <- Minus
3R 17034134..17034329 1583..1778 100 <- Minus
3R 17033965..17034070 1779..1884 100 <- Minus
3R 17033826..17033906 1885..1965 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:32:35 Download gff for BO28179.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12860515..12861740 17..1242 99   Minus
arm_3R 12860110..12860449 1243..1582 100 <- Minus
arm_3R 12859856..12860051 1583..1778 100 <- Minus
arm_3R 12859687..12859792 1779..1884 100 <- Minus
arm_3R 12859548..12859628 1885..1965 97 <- Minus

BO28179.pep Sequence

Translation from 16 to 1981

> BO28179.pep
MRVFLVVLSVLSVAVATKCPYSAMEPSLSRSKRSSFDIRPGVSDGSLDAL
IKEFMPKYNGNNVHNSWAEPSASQQPLRCGVPPRNCLNDTRNLHYRTLDG
SCNNLLYPEFGIAVSRYRRLLPPRQVEQAPNARLISLSLYGEQTRNDRFR
TMAAMQWGQFVAHDISQLSTQGAPQDCCAEPRHPRCLPINLPRGGPIAYH
TGKTCLHFARSVSDADAICPKVEEPQPEKLTVATAYLDLSSIYGNNPSQN
RKVRLFKGGLLKTSYTNGQHWLPVSQNENGECGAKSECYIVPDIRNRFSP
TIALLQTLLVREHNRLAENLALINPDHSDERIFQEARKINIAQFQKITYY
DWLPLFVGRTYTYLNGLIYPVEPTEYVNDYDETVNPAAYAEFSAAAFRYA
HTQIPGWFSLVAPNRRSNRTMRLSDFLDRTETIRLLDTSDNFDALLRGLA
TQLHKRSDGNIDREIKHYFNRKEFEEYGSDLKSIDIQRARDFGLASYNDV
REFCGLRRAVDWADFAHEIPGEKISLLRRLYATPDDVELGVGGTLEYHVP
DALFGPTLLCVIGKQFLNTRRGDRFFFERENEGGFSRAQLAEIRKVSLSS
LFCSNANYLHLIQPNVFVFPNSHNLLLNCNFIPQIDLSKWQDLRPQLVHA
SFLDH

BO28179.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG4009-PC 649 CG4009-PC 1..649 1..649 3446 100 Plus
CG4009-PB 649 CG4009-PB 1..649 1..649 3446 100 Plus
Pxd-PC 688 CG3477-PC 91..673 79..642 1212 43.1 Plus
Pxd-PB 690 CG3477-PB 93..675 79..642 1212 43.1 Plus
Pxd-PA 690 CG3477-PA 93..675 79..642 1212 43.1 Plus