Clone BO28193 Report

Search the DGRC for BO28193

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:281
Well:93
Vector:pDNR-Dual
Associated Gene/Transcriptkar-RB
Protein status:BO28193.pep: Imported from assembly
Sequenced Size:1870

Clone Sequence Records

BO28193.complete Sequence

1870 bp assembled on 2011-07-18

GenBank Submission: KX794136

> BO28193.complete
GAAGTTATCAGTCGACATGGCTGAGAATGAACCGCTGAACGACCTGCAGA
GCCAGGTGAATGGTCGTATCCTGCCCGCCGCCAATGGACATACAGCATCC
GCGACCAACGGATTGGTGCATGCGAATGGCAAGGATGCAATGAAGCCGTC
AGCTCCCGTTCAGAATGGGAATGGCAACGCGAACGGGACACACATCGAGG
CGCCCTGCTGTCGGGACATACACGGCAAGGAGCCACCGGACGGAGGAGCA
CGCGCCTGGCTGGTCATGGTGAGCGCCTTCCTTTGCAACGGCATCATCTT
TGGGTTCATCAACACCTACGGCGTTATCCATTCGCTGCTGACGGATAGGC
TTACGAAGCTCGGCGATCCGGAGGCGTCCAGCAAAGCGGCTCTGATTGGC
GCCCTGGCCATCGGCACCACATTCCTCTTCTCCACAATGGCTGGCTGTCT
GACGGACAAGATTGGCCTGCGGCTGACCACGTTCGCCGGCGGAGTCCTCT
CCGCGGGAGGACTGCTGCTGTCCTCGTTTTGCACGGAGAACATCGGCGCC
CTGTACTTCACCTACGGGATCATGTTCGGCCTGGGTGCCGCCCTTGCCTA
CACGCCCACATTGGCCATCCTGGGCCACTATTTCAAGCGGTACCTGGGAA
AGGTGAGTGGCTTTGTGACCGCCGGCTCCAGCGTTTTCACTGTGATACTG
CCGCCCTGTCTGGACAAGCTGCTCGGTAGCTATGGTCTGGAGGGGACCCT
GCGGATAATGAGCCTCGTTTCCGCCTTTATTATCCTTTGCTCCTTCGTGT
ACAAGCCACTGCATCCGCCACCGGAGCCGCCGAAGAAGAAGCCCGGCAGA
TCGCGCATCAATCTCTTCCTACGCTCGATCATCAACGTGGAGATCTGGAA
GCGTAAACGCTTCGTCATCTGGGCACTTTGTGTGCCGCTCGCCTTGTTCG
GCTACTTTGTGCCCTATGTGCACATGATGCAGTTCGTGAAAACCACTTTT
CCGGGAGAGGATGTCAACCTGCCGGTCATGTGTATCGGCATCACCTCCGG
CATCGGGCGTCTGATTTTCGGAGTCATTGCCGATATGCCGGGTGTGAACC
GTATGTACCTGCAACAATTGTCCTTGGTGTCCATTGGCCTGGTTACCTTG
CTGCTGCCGCTCACCAACTCGTACGTCATCCTCGTCTCGTTCACCCTGGT
CATGGGTCTTTTCGACGGCTGCTTCATTTCGCTGCTGGGCCCAATAGCCT
ACGAGATCTGTGGCCCCTCGGGCGCCACACAGGCCATCGGCTTTCTGCTA
GGACTCAGTTCTATTCCGCTCACAGTGGGTCCACCAGTGGCGGGCATGAT
CTTCGACAGCACGAACTCCTACACATTGCCGCTGATCCTCGCCGGACTCC
CCCCACTACTTGGCTCCTCGCTCTTGTTCCTCATCAAGTGCGTCAAGGAG
GAGGAGAACGGGGTCAGTGCGCCGCGAGCGGTGGTACTGGCCAATGGAGA
CATCGAGATTGCCGGCAACGGCCATTATCGGTCGGCTGGCACCAAGTCCA
GTGCACCGCTGATGGGTGCCACGAATGGTATCAATGGAAGCGCACCAGCG
TCCCCAACTATCCAGAGCAATGGACACGTGGACAACGGAACTGGTTCGTA
CCCCGACTCACCTTGGCCTAGCCCCACTCGCATCTCAGACTCCGCCGCCT
GCGACCATTCCAGTAGCTCGCTTCACACTAACCCGGGCACCCTGCTGCCC
AGCTGCTCGCACACCGCCCTGCTGAGCGGGCGCTCTGGCTCCAGCAAGTC
CCTGCCCCTGGGCGACGAACCCAAGAGGCGTCGCTATAACTACTCCATCT
ACGCAAGCTTTCTAGACCAT

BO28193.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
kar-RB 1839 CG12286-PB 1..1836 17..1852 9180 100 Plus
kar-RA 1662 CG12286-PA 1..1628 17..1644 8140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
kar-RB 2321 CG12286-RB 192..2028 16..1852 9185 100 Plus
kar-RA 2176 CG12286-RA 192..1820 16..1644 8145 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12683314..12684099 1539..754 3930 100 Minus
3R 32079331 3R 12687716..12688089 389..16 1870 100 Minus
3R 32079331 3R 12684154..12684523 758..389 1835 99.7 Minus
3R 32079331 3R 12682928..12683242 1852..1538 1575 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:39:35 has no hits.

BO28193.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-18 15:33:47 Download gff for BO28193.complete
Subject Subject Range Query Range Percent Splice Strand
kar-RB 193..2028 17..1854 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:32:50 Download gff for BO28193.complete
Subject Subject Range Query Range Percent Splice Strand
kar-RB 193..2028 17..1854 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:53 Download gff for BO28193.complete
Subject Subject Range Query Range Percent Splice Strand
kar-RB 193..2028 17..1854 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:53 Download gff for BO28193.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12687716..12688088 17..389 100   Minus
3R 12684158..12684522 390..754 100 <- Minus
3R 12683315..12684098 755..1538 100 <- Minus
3R 12682926..12683241 1539..1854 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:32:50 Download gff for BO28193.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8513438..8513810 17..389 100   Minus
arm_3R 8509880..8510244 390..754 100 <- Minus
arm_3R 8509037..8509820 755..1538 100 <- Minus
arm_3R 8508648..8508963 1539..1854 99 <- Minus

BO28193.pep Sequence

Translation from 16 to 1870

> BO28193.pep
MAENEPLNDLQSQVNGRILPAANGHTASATNGLVHANGKDAMKPSAPVQN
GNGNANGTHIEAPCCRDIHGKEPPDGGARAWLVMVSAFLCNGIIFGFINT
YGVIHSLLTDRLTKLGDPEASSKAALIGALAIGTTFLFSTMAGCLTDKIG
LRLTTFAGGVLSAGGLLLSSFCTENIGALYFTYGIMFGLGAALAYTPTLA
ILGHYFKRYLGKVSGFVTAGSSVFTVILPPCLDKLLGSYGLEGTLRIMSL
VSAFIILCSFVYKPLHPPPEPPKKKPGRSRINLFLRSIINVEIWKRKRFV
IWALCVPLALFGYFVPYVHMMQFVKTTFPGEDVNLPVMCIGITSGIGRLI
FGVIADMPGVNRMYLQQLSLVSIGLVTLLLPLTNSYVILVSFTLVMGLFD
GCFISLLGPIAYEICGPSGATQAIGFLLGLSSIPLTVGPPVAGMIFDSTN
SYTLPLILAGLPPLLGSSLLFLIKCVKEEENGVSAPRAVVLANGDIEIAG
NGHYRSAGTKSSAPLMGATNGINGSAPASPTIQSNGHVDNGTGSYPDSPW
PSPTRISDSAACDHSSSSLHTNPGTLLPSCSHTALLSGRSGSSKSLPLGD
EPKRRRYNYSIYASFLDH

BO28193.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
kar-PB 612 CG12286-PB 1..612 1..612 3186 100 Plus
kar-PA 553 CG12286-PA 1..543 1..543 2813 100 Plus
CG11665-PB 658 CG11665-PB 8..234 37..265 285 33.3 Plus
CG11665-PA 658 CG11665-PA 8..234 37..265 285 33.3 Plus
Mct1-PB 626 CG3456-PB 417..603 288..473 250 28.9 Plus